IP Address Lookup
Get hostname and Geo location
info for any IP



Help
Whois Lookup
Get contact info for a domain/ip
Help
Traceroute
Shows network route to host
Your iP is: 216.73.216.12 United States Near: United States

This is where you are:

IP Information - 216.73.216.12

Host name: 216.73.216.12

Country: United States

Country Code: US

Region:

City:

Latitude: 37.751

Longitude: -97.822

Sam is reporting 101.100.179.4

IP 101.100.179.4 tried to login to my website

IP identified as: Website IP, Reported on: 27th, May. 2022
علي is reporting 213.186.153.50

اااا

IP identified as: IP للجهاز المحÙ, Reported on: 27th, May. 2022
EugeneRar is reporting /lookup_whois.php

歐客佬精品咖啡 |OKLAO COFFEE|蝦皮商城|咖啡豆|掛耳|精品咖啡|咖啡禮盒 專賣|精品麵包 https://first-cafe.com/

Reported on: 28th, May. 2022
Angele Angelita mine sin is reporting 174.253.2.7

Off.inbent

Reported on: 28th, May. 2022

я гадюка. я жив в україні в маріополі зараз живу в польщі. де знайти роботу??? гадюка

Reported on: 28th, May. 2022

Hello, Music private FTP service is a community for DJ’s & fans that helps you gain full access to exclusive electronic music. https://0daymusic.org https://0daymusic.org/FTPtxt/ Best Regards, 0daymusic Team

Reported on: 28th, May. 2022
Rafael Garcia is reporting 38.50.44.2

we have block 38.50.44.0/24 in the Dominican Republic, Cotui. please update a location

IP identified as: This is my IP, Reported on: 28th, May. 2022
Matt is reporting 35.227.62.178

Discord hacker

IP identified as: Hackers IP, Reported on: 29th, May. 2022
Ed is reporting 52.100.7.213

Constant multiple spam from them and Microsoft does nothing!

IP identified as: Spammers IP, Reported on: 29th, May. 2022
iShowSpeed is reporting 74.133.60.195

HELL NA I DIDNT MEAN TO LEAK MY IP DELETE THIS BRO!

IP identified as: This is my IP, Reported on: 29th, May. 2022
ed is reporting 52.100.17.225

More spam

IP identified as: Spammers IP, Reported on: 29th, May. 2022
ed is reporting 52.100.17.214

more spam

IP identified as: Spammers IP, Reported on: 29th, May. 2022
ed is reporting 52.100.18.227

more spam

IP identified as: Spammers IP, Reported on: 29th, May. 2022
jayden is reporting 74.133.60.195

rip speed, gl with the fans showing up

Reported on: 29th, May. 2022
Ed Tate is reporting 166.205.190.7

I don't even know where to start. This shows as my iPhone but it isn't. Been hacked and abused each day by these bandits. Astarpools@gmail.com. am confused and out of any answers . I "hear" these people speak on my home. Idk how but it is there . Recording if you like at my YouTube page. Strangest thing ever. Eddy Tate the v2k recordings. But yes today this one.. I'm in Waxahachie TX, not this place. Thank you

IP identified as: Hackers IP, Reported on: 29th, May. 2022
ed is reporting 40.107.138.89

more spam

IP identified as: Spammers IP, Reported on: 30th, May. 2022
ed is reporting 52.100.19.96

more spam

IP identified as: Spammers IP, Reported on: 30th, May. 2022
ed is reporting 52.100.9.220

more spam

IP identified as: Spammers IP, Reported on: 30th, May. 2022
ed is reporting 52.100.18.210

more spam

IP identified as: Spammers IP, Reported on: 30th, May. 2022
ed is reporting 52.100.174.218

more spam

IP identified as: Spammers IP, Reported on: 30th, May. 2022
ed is reporting 52.100.7.201

more spam

IP identified as: Spammers IP, Reported on: 30th, May. 2022
ed is reporting 40.107.7.77

more spam

IP identified as: Spammers IP, Reported on: 30th, May. 2022
LEMOINE is reporting 209.85.215.196

ENGLISH VERSION : RECEIPT again these same emails stolen French LA POSTE using mails boxes and IP Address of GOOGLE FRANÇAIS : RECEPTION mêmes emails d'escroqueries usurpant ENCORE LA POSTE en France avec adresse email bidon en GMAIL Bonjour Webmasters de LAPOSTE.net, et SIGNAL SPAM, et alertespam@labanquepostale.fr et abuse@ripe.net et hostmaster@ripe.net et abuse@google.com et abuse@gmail.com et network-abuse@google.com et arin-contact@google.com et fraude-bretic@interieur.gouv.fr and F.B.I. Services in U.S.A ( for Google ) in hidden copy for Adress IP in U.S.A ( https://complaint.ic3.gov/default.aspx ) Et celà continue toujours fin Mai 2022 et ceci depuis au moins +17 années ( emails tous archivés complets avec tous leurs codes HTML depuis 2007 )( il y a forcément des complicités, du laxisme, des incompétents d’Etats et Services Administratifs chez des fournisseurs d’accès, depuis toutes ces +17 années que celà dure ! Ces escrocs ont vraiment la belle vie pour sévir en France ! Ce Lundi 30 Mai 2022 après 20h10 ( et très souvent les week-ends, ou très souvent les nuits, avant ou après les horaires des Bureaux et Administrations en France, méthodes de faux-culs et d’escrocs ) j'ai encore reçu sur ma boite email ce même email d’escroqueries avec faux contenu de LAPOSTE et venant de l'adresse email bidon ou usurpée,volée : ouattarayaya331@gmail.com Les adresses IP utilisées par le PC de ce(s) batards de hackers fous, débiles, têtus, butés, et analphabètes ( incapables d’écrire correctement le Français ) et ces mails sont préparés, envoyés en différés qqs heures ( 01h38 cette nuit ) ou 1 jour avant, pour ne pas être tracés par un logiciel Sniffer sur leurs adresses Mac de cartes réseaux, ou par des commandes Traceroute sur leurs adresses IP en direct ( bandes de poules mouillées, fumiers, trouillards ! ): 209.85.215.196 aux U.S.A ! Received : from mail-pg1-f196.google.com (mail-pg1-f196.google.com [209.85.215.196]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by mlpnf0113.laposte.net (SMTP Server) with ESMTPS id 4LBk3D5tDQzYcmf for <@laposte.net>; Mon, 30 May 2022 20:10:16 +0200 (CEST) Received : by mail-pg1-f196.google.com with SMTP id j21so10698959pga.13 for <@laposte.net>; Mon, 30 May 2022 11:10:16 -0700 (PDT) From : "Utulisateur+" <ouattarayaya331@gmail.com> Date : Mon, 30 May 2022 20:10:05 +0200 IP Lookup Details: IP Information - 209.85.215.196 Host name: mail-pg1-f196.google.com Country: United States Country Code: US Region: City: Latitude: 37.751 Longitude: -97.822 utilisant encore des boites emails de GOOGLE et les serveurs IP de chez GOOGLE. C'est visiblement et clairement une tentative de phishing et fraude ( fautes de grammaire multiples ) Ci-dessous cet email d’escroquerie avec ces en-têtes complets : ***************** CONTENU du mail d’escroquerie ******************* Re: Accès à votre compte • Aujourd'hui, à 20:10 (il y a une heure) 26Ko • • • De : Utulisateur+ • A : undisclosed-recipients:; • 1 pièce jointe • Cher utilisateur Laposte 50 -9- -1- (1).docx Cher utilisateur Laposte 50 -9- -1- (1).docx [16Ko] o o Télécharger Télécharger Cher (e) Abonné(e) Nous vous avons récemment informé des mises à jour concernant la manière dont nous traitons vos données, conformément à la réglementation de l’Union Européenne sur la protection des données personnelles. Veuillez prendre connaissance du document sans le télécharger. L'Équipe Laposte Mail ************** Codes HTML complets ci-dessous *********************** Return-Path : <ouattarayaya331@gmail.com> Received : from mlpnf0113.laposte.net (mlpnf0113.sys.meshcore.net [10.94.128.92]) by mlpnb0108 with LMTPA; Mon, 30 May 2022 20:10:17 +0200 X-Cyrus-Session-Id : cyrus-17524-1653934217-1-17137205013362290251 X-Sieve : CMU Sieve 3.0 X-mail-filterd : {"version":"1.4.3","queueID":"4LBk3F2Lg7zYcmd","contextId":"ef3f6169-40f0-480f-9293-a6448a69e8ef"} X-ppbforward : {"queueID":"4LBk3F2Lg7zYcmd","server":"mlpnf0113"} Received : from outgoing-mail.laposte.net (localhost.localdomain [127.0.0.1]) by mlpnf0113.laposte.net (SMTP Server) with ESMTP id 4LBk3F2Lg7zYcmd for <lpn000000000000000018870443@back01-mail02-04.lpn.svc.meshcore.net>; Mon, 30 May 2022 20:10:17 +0200 (CEST) X-mail-filterd : {"version":"1.4.3","queueID":"4LBk3D5tDQzYcmf","contextId":"c99b2926-146e-4326-921d-ff84285d7f9f"} X-lpn-mailing : LEGIT X-lpn-spamrating : 48 X-lpn-spamlevel : not-spam Authentication-Results : laposte.net; spf=pass smtp.mailfrom=ouattarayaya331@gmail.com smtp.helo=mail-pg1-f196.google.com; dkim=pass reason="good signature" header.d=gmail.com header.s=20210112 header.b=gaUYRe; dmarc=pass reason="SPF is aligned, DKIM is aligned"; bimi=skipped reason="non-compliant DMARC" X-lpn-spamcause : OK, (40)(0000)gggruggvucftvghtrhhoucdtuddrgedvfedrkeeigdduudekucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecunfetrffquffvgfdpggftfghnshhusghstghrihgsvgenuceurghilhhouhhtmecufedtudenucgouhhnughishgtlhhoshgvugculdegtddmnecujfgurhepggfhfffkufgtsehmtderredttdejnecuhfhrohhmpedffghtuhhlihhsrghtvghurhdofdcuoehouhgrthhtrghrrgihrgihrgeffedusehgmhgrihhlrdgtohhmqeenucggtffrrghtthgvrhhnpedutdejfeeitdduvefhueekleeileekjeefgeeujeeuvdeuuedvgeeugeeuudffleenucfkphepvddtledrkeehrddvudehrdduleeinecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepvddtledrkeehrddvudehrdduleeipdhhvghlohepmhgrihhlqdhpghduqdhfudeliedrghhoohhglhgvrdgtohhmpdhmrghilhhfrhhomhepohhurghtthgrrhgrhigrhigrfeefudesghhmrghilhdrtghomhdpnhgspghrtghpthhtohepuddprhgtphhtthhopegvlhgvrdhlvghmohhinhgvsehlrghpohhsthgvrdhnvghtpdhsphhfpehprghsshdpughkihhmpehprghsshdpughmrghrtgepphgrshhs Received : from mail-pg1-f196.google.com (mail-pg1-f196.google.com [209.85.215.196]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by mlpnf0113.laposte.net (SMTP Server) with ESMTPS id 4LBk3D5tDQzYcmf for <ele.lemoine@laposte.net>; Mon, 30 May 2022 20:10:16 +0200 (CEST) Received : by mail-pg1-f196.google.com with SMTP id j21so10698959pga.13 for <ele.lemoine@laposte.net>; Mon, 30 May 2022 11:10:16 -0700 (PDT) DKIM-Signature : v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20210112; h=mime-version:from:date:message-id:subject:to; bh=d5u+5qtG1BSfTNlKzuF9D2fnqcyzNF/4F2kcoKeDqzA=; b=gaUYRestl6L6s8QIBbRdNV2bvsoaeX42FNjrxma3s1lwbX4qzjpSFtaBu3F+VF/Y2t 2csUo8kBeQzMBe/lGEQmq41DWw91jJyO0oAjCD75wVK63JXE5kazRIAJhYUwFTLdYPJj cloM/KMYXSNVL3iEeIpxaS7nZ61mFkWK41giotSpl9+LaRMRZ1itOi7AbvyMuVSgb1Xu HuK3vxERQcrvtfdkI3k92CNDvUsFHACDAfQWUAshlR8z+tE0FG5e9FbBrnZ/q9jBSI4w hQWQ9XRD/ZzqSc5rFB/omAHTVDZ1Bb5xyXcmeZZhcUzZcvqBwrNEM5HstY4Uzr+6jDfx t67g== X-Google-DKIM-Signature : v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20210112; h=x-gm-message-state:mime-version:from:date:message-id:subject:to; bh=d5u+5qtG1BSfTNlKzuF9D2fnqcyzNF/4F2kcoKeDqzA=; b=bDA4nuwH56VqsIwScYs53yC2w2y7mwCZrdSKUBO4qWcvAfS4n/u5+RrYw0XwZL2WKu L5BzJnQSOKOJ8TLNPjIi163qLt2Eioo5DfZdOn8nOVbET/7Z0+u8uE8i/hYowmEmNeGs 56882Vxdv0m2fZo8rsGyflWQyjMlUFU6o0Y33YcNM54zrZWvFwK5snFEep/O+QqI8tV+ OgqlMK+zhdf2daLD8vV19b175lmz38wyR8X5SuA447VRe1pOjT8TnppjqId2aym2zsaN hDv2Qshfo+zW4Y2BZCYCBDplrr1COf3agpS0wKGnuW0u36dOWKDEF7wlLCuK1XXiRalT emWg== X-Gm-Message-State : AOAM531kW732oB9+tHaE4IyWaV281Ja6FKxiKGnaK53Br/6CNX133aox p1klH7lHY4V0Th4WyPna7hbaEAerCd6AsixFmcI= X-Google-Smtp-Source : ABdhPJwYipobR0I6agsPE/Dm8GPwO+3n0Rt3oP3jif7uO+TzA5tI95KtUeal+iVONCHLwbN7/rjD+6xx7wOEpwx/SU4= X-Received : by 2002:a63:ee57:0:b0:3fa:8a91:6826 with SMTP id n23-20020a63ee57000000b003fa8a916826mr29884383pgk.93.1653934215481; Mon, 30 May 2022 11:10:15 -0700 (PDT) MIME-Version : 1.0 From : "Utulisateur+" <ouattarayaya331@gmail.com> Date : Mon, 30 May 2022 20:10:05 +0200 Message-ID : <CA+Bxi10z8yKw1C+g1aTViA03J4kasKnJcC83208S=+Q8qAd-wQ@mail.gmail.com> Subject : Re: Accès à votre compte To : undisclosed-recipients:; Content-Type : multipart/mixed; boundary="00000000000065898605e03e9159

IP identified as: Hackers IP, Reported on: 30th, May. 2022
Aakash Grg is reporting 120.89.105.68

IAM hack

IP identified as: Office IP, Reported on: 31st, May. 2022
WFS is reporting 104.17.91.109

IP 104.17.91.109

IP identified as: Hackers IP, Reported on: 31st, May. 2022
Previous  422 423 424 425 426 427 428 429 430 431 432 Next 
Expand section List of Class A IP ranges (click to view)