Get hostname and Geo location
info for any IP



Whois Lookup
Get contact info for a domain/ip
Traceroute
Shows network route to host
Your iP is: 44.192.254.246 United States Near: Ashburn, Virginia, United States

This is where you are:

IP Information - 44.192.254.246

Host name: ec2-44-192-254-246.compute-1.amazonaws.com

Country: United States

Country Code: US

Region: CA

City: San Diego

Latitude: 32.8072

Longitude: -117.1649

Nesru muhamed is reporting 196.191.48.235

Yet alle shelematu

Reported on: 20th, Sep. 2021
Jacqueline is reporting 192.168.68.106

This IP address continues to access my laptop and actively attacks my company domains which is hosted by Webspace Bar and is connected to my laptop remotely.

IP identified as: Hackers IP, Reported on: 20th, Sep. 2021

Привет. Посоветуйте хорошую онлайн-типографию для печати визиток Мы работали с одной типографией, качество, цены и скорость у них хорошее, но они находятся в Красноярске, а мне нужно в Москве. Это печать на почтовых конвертах https://4uprint.ru/products/konverty

Reported on: 20th, Sep. 2021
Paulo is reporting 88.209.250.130

attempted to login into my QNAP nas with admin creds

IP identified as: Hackers IP, Reported on: 19th, Sep. 2021
LEMOINE is reporting 54.240.8.195

Receipt a lots of, many mails stolen PAYPAL, using again emails boxes AMAZONSES.com for touching email French boxes LAPOSTE.net Réception 7ème email d'arnaque usurpant PAYPAL.fr via encore les boites emails AMAZONSES.com envoyé sur les boites mails à la POSTE.net Bonjour Webmasters de SIGNAL SPAM, SIGNAL-ARNAQUES.com, LA POSTE.net, et spoof@PAYPAL.com, et stop-spoofing@amazon.com Et celà continue encore en Septembre 2021 et ceci depuis au moins +15 années ( emails tous archivés complets avec tous leurs codes HTML depuis 2007 )( il y a forcément des complicités, du laxisme d’Etats, ou des incompétents dans des Administrations, chez des fournisseurs d’accès, depuis ces +15 années que celà durent ! Ces escrocs ont la belle vie pour sévir en France! Ce Dimanche 19 Septembret 2021 après 07h28 ( et très souvent aussi les nuits, et les week-ends, avant les ouvertures ou après les Fermetures des Bureaux et Administrations en France )( méthodes d’escrocs et de faux culs ) j'ai ENCORE reçu sur ma boite email ce nouvel email ci-dessous d’escroquerie Bancaire avec faux contenu PAYPAL et venant ENCORE d’adresses emails AMAZONSES.com L’adresse IP utilisée par le PC ou Smartphone de ces batards de hackers fous est ENCORE cette fois-ci : 54.240.8.195 ville de Seattle aux USA Received : from a8-195.smtp-out.amazonses.com (a8-195.smtp-out.amazonses.com [54.240.8.195]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-SHA256 (128/128 bits)) (No client certificate requested) by mlpnf0120.laposte.net (SMTP Server) with ESMTPS id 4HBx7Y5HCMznTV6 IP Lookup Details: IP Information - 54.240.8.195 Host name: a8-195.smtp-out.amazonses.com Country: United States Country Code: US Region: WA City: Seattle Latitude: 47.5839 Longitude: -122.2995 utilisant ENCORE et toujours des boites mails de la Société AMAZONSES.com C'est visiblement et clairement une tentative d’escroquerie ! ********** Contenu de cet email d’escroquerie ************** Vérification de votre achat sur Hostinger I.L. • Aujourd'hui, à 07:28 (il y a 14 heures) 15Ko • • • De : Notification • A : @laposte.net • Jul 19, 2020 06:13:07 PDT ID de la transaction: Cher client, Vous avez envoyé un paiement de 11,95 EUR à Hostinger International Limited (clients@hostinger.com) Si vous n'avez pas autorisé cette transaction, veuillez Marchand Hostinger International Limited clients@hostinger.com +357 35737004503378 Instructions au vendeur Vous n'avez saisi aucune instruction. Description Prix unitaire Qté Montant €11.95 EUR 1 €11.95 EUR Subtotal €11.95 EUR Total €11.95 EUR N° facture: 81362 Déclaration de litige? Vous disposez d'un délai de 180 jours à compter de la date de la transaction pour ouvrir un litige au Centre de résolution. Copyright © 1999-2020. Tous droits réservés. ************* Codes HTML ci-dessous ****************** Entêtes du mail Return-Path : <0100017bfc8766ab-f4fb488f-cfaf-4a04-a999-4cc5b810ffed-000000@amazonses.com> Received : from mlpnf0120.laposte.net (mlpnf0120.sys.meshcore.net [10.94.128.99]) by mlpnb0108 with LMTPA; Sun, 19 Sep 2021 07:28:58 +0200 X-Cyrus-Session-Id : cyrus-163927-1632029338-1-6005824382640198179 X-Sieve : CMU Sieve 3.0 X-mail-filterd : {"version":"1.3.1","queueID":"4HBx7Z0svmznTV5","contextId":"de80b869-ad2d-4684-88d7-0de553dddf64"} X-ppbforward : {"queueID":"4HBx7Z0svmznTV5","server":"mlpnf0120"} Received : from outgoing-mail.laposte.net (localhost.localdomain [127.0.0.1]) by mlpnf0120.laposte.net (SMTP Server) with ESMTP id 4HBx7Z0svmznTV5 for <lpn000000000000000018870443@back01-mail02-04.lpn.svc.meshcore.net>; Sun, 19 Sep 2021 07:28:58 +0200 (CEST) X-mail-filterd : {"version":"1.3.1","queueID":"4HBx7Y5HCMznTV6","contextId":"d977d098-f7c9-459b-bf32-f9dc87e9b2a6"} X-lpn-mailing : Purchases X-lpn-spamrating : 42 X-lpn-spamlevel : not-spam Authentication-Results : laposte.net; spf=pass smtp.mailfrom=0100017bfc8766ab-f4fb488f-cfaf-4a04-a999-4cc5b810ffed-000000@amazonses.com smtp.helo=a8-195.smtp-out.amazonses.com; dkim=pass reason="good signature" header.d=amazonses.com header.s=ug7nbtf4gccmlpwj322ax3p6ow6yfsug header.b=groQ4L; dmarc=fail reason="SPF is not aligned, DKIM is not aligned" message-context : purchase X-lpn-spamcause : OK, (10)(14000)gggruggvucftvghtrhhoucdtuddrgedvtddrudehledgledvucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecunfetrffquffvgfdpggftfghnshhusghstghrihgsvgenuceurghilhhouhhtmecufedttdenucdnrfhurhgthhgrshgvucdluddtmdenucfjughrpegghffvfffutgfgkfeshhgsredttddtjeenucfhrhhomheppfhothhifhhitggrthhiohhnuceotghithhisghothgrlhgvrhhtrghssehgmhgrihhlrdgtohhmqeenucggtffrrghtthgvrhhnpedviefftdffleehgeevffdvudehvdeugeevueffvdehgeeggfekvefgteetheehgeenucffohhmrghinhepshhlvggrkhgvrhdrnhgvthenucfkphepheegrddvgedtrdekrdduleehnecuuegrugftvghpuhhtgfhmrghilheptghithhisghothgrlhgvrhhtrghssehgmhgrihhlrdgtohhmpdgtlhhivghnthhssehhohhsthhinhhgvghrrdgtohhmnecuvehluhhsthgvrhfuihiivgepudenucfrrghrrghmpehinhgvthepheegrddvgedtrdekrdduleehpdhhvghloheprgekqdduleehrdhsmhhtphdqohhuthdrrghmrgiiohhnshgvshdrtghomhdpmhgrihhlfhhrohhmpedtuddttddtudejsghftgekjeeiiegrsgdqfhegfhgsgeekkehfqdgtfhgrfhdqgegrtdegqdgrleelledqgegttgehsgekuddtfhhfvgguqddttddttddttdesrghmrgiiohhnshgvshdrtghomhdprhgtphhtthhopegvlhgvrdhlvghmoh hinhgvsehlrghpohhsthgvrdhnvght Received : from a8-195.smtp-out.amazonses.com (a8-195.smtp-out.amazonses.com [54.240.8.195]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-SHA256 (128/128 bits)) (No client certificate requested) by mlpnf0120.laposte.net (SMTP Server) with ESMTPS id 4HBx7Y5HCMznTV6 for <ele.lemoine@laposte.net>; Sun, 19 Sep 2021 07:28:57 +0200 (CEST) DKIM-Signature : v=1; a=rsa-sha256; q=dns/txt; c=relaxed/simple; s=ug7nbtf4gccmlpwj322ax3p6ow6yfsug; d=amazonses.com; t=1632029337; h=MIME-Version:From:To:Date:Subject:Content-Type:Content-Transfer-Encoding:Message-ID:Feedback-ID; bh=zqN8hjP8fTBER9cDxzj5+bF4rtXv3WZ5aEGUF5nA6gY=; b=groQ4Lva6WXUTjvZx0DGxZBIlLU9Hj2td2fvuV/OooLJ2gVvzEk7Z5vDS5yabMlg SVuopnR8BPUmfylo1r7/BXOS8ue+FJ+4Wmbn1S7xQ+ljD18eVhuPDoYD5NMhVdIs1e0 kMDmfZYqRnmq7X5JLGsXjeRr47ZU1BDxDK9tS79I= MIME-Version : 1.0 From : Notification <citibotalertas@gmail.com> To : ele.lemoine@laposte.net Date : Sun, 19 Sep 2021 05:28:57 +0000 Subject : Vérification de votre achat sur Hostinger I.L. Content-Type : text/html; charset=utf-8 Content-Transfer-Encoding : base64 Message-ID : <0100017bfc8766ab-f4fb488f-cfaf-4a04-a999-4cc5b810ffed-000000@email.amazonses.com> Feedback-ID : 1.us-east-1.k53+E9Xsw4QJPBmHeUKrgOp4JcVLWTFHoT12omA32Mw=:AmazonSES X-SES-Outgoing : 2021.09.19-54.240.8.195

IP identified as: Hackers IP, Reported on: 19th, Sep. 2021
Rose is reporting 107.126.65.25

Using this IP to hack into email accounts and facebooks.

IP identified as: Hackers IP, Reported on: 19th, Sep. 2021
Hassan Ahmad is reporting 102.91.4.177

100.81.102.210

IP identified as: This is my IP, Reported on: 19th, Sep. 2021

Я лет 10 уже прогоняю на Хрумере любые темы ( серые, белые) и свой сайт тоже. Звоните. Пример работы и тел. здесь http://www.1541.ru/hrym.html Антибан со стороны гугла гарантирован. Ahrefs- у все нравится. цена 50 или 120 usd за месяц

Reported on: 19th, Sep. 2021

Have you ever considered about including a little bit more than just your articles? I mean, what you say is valuable and all. Nevertheless think of if you added some great images or video clips to give your posts more, "pop"! Your content is excellent but with pics and video clips, this blog could undeniably be one of the best in its niche. Terrific blog!

Reported on: 18th, Sep. 2021
Nayak is reporting 223.191.36.135

IP: 223.191.36.135

IP identified as: This is my IP, Reported on: 18th, Sep. 2021
Kumar is reporting 223.191.36.135

IP: 223.191.36.135

IP identified as: Mobile device IP, Reported on: 18th, Sep. 2021
Hemant is reporting 223.191.36.135

IP: 223.191.36.135

IP identified as: Mobile device IP, Reported on: 18th, Sep. 2021
Hemant is reporting 223.191.36.135

IP: 223.191.36.135

IP identified as: This is my IP, Reported on: 18th, Sep. 2021
Sipho Gabriel Mbaxa is reporting 197.245.161.150

If your can teach me how to use my IP, and protect it. I'm Sipho Gabriel Mbaxa.

IP identified as: This is my IP, Reported on: 18th, Sep. 2021

https://kinogo.io/13318-veselaja-karusel-3-1971.html

Reported on: 17th, Sep. 2021
Anonymous is reporting 122.42.210.169

122.42.210.169

IP identified as: 이것은 내 IP입니다, Reported on: 17th, Sep. 2021
Joshua Avila is reporting 12.250.169.202

What thevhell this mean

IP identified as: Residentail IP, Reported on: 17th, Sep. 2021
Abdullah abdrabuh is reporting 140.238.15.248

wip site 700.ر.س.

Reported on: 17th, Sep. 2021
Anonymous is reporting 188.48.160.15

192.168.100.1

IP identified as: Wireless IP, Reported on: 16th, Sep. 2021
No is reporting 13.226.241.125

getting DoS attacks from this ip: 13.226.241.125

IP identified as: Hackers IP, Reported on: 16th, Sep. 2021
No is reporting 13.226.255.106

getting Dos attacks from this ip: 13.226.255.106

IP identified as: Hackers IP, Reported on: 16th, Sep. 2021
No is reporting 13.225.143.58

getting Dos attacks from this ip: 13.225.143.58

IP identified as: Hackers IP, Reported on: 16th, Sep. 2021
No is reporting 151.101.25.188

Getting Dos attacks from this ip: 151.101.25.188

IP identified as: Hackers IP, Reported on: 16th, Sep. 2021
26.112.58.183 is reporting 26.112.58.183

26.112.58.183

IP identified as: Residentail IP, Reported on: 16th, Sep. 2021
 1 2 3 4 5 6 7 8 9 10 11 Next 
List of Class A IP ranges (click to view)
* 1.0.0.0 - 1.255.255.255 (1.0.0.0/8)
* 2.0.0.0 - 2.255.255.255 (2.0.0.0/8)
* 3.0.0.0 - 3.255.255.255 (3.0.0.0/8)
* 4.0.0.0 - 4.255.255.255 (4.0.0.0/8)
* 5.0.0.0 - 5.255.255.255 (5.0.0.0/8)
* 6.0.0.0 - 6.255.255.255 (6.0.0.0/8)
* 7.0.0.0 - 7.255.255.255 (7.0.0.0/8)
* 8.0.0.0 - 8.255.255.255 (8.0.0.0/8)
* 9.0.0.0 - 9.255.255.255 (9.0.0.0/8)
* 10.0.0.0 - 10.255.255.255 (10.0.0.0/8)
* 11.0.0.0 - 11.255.255.255 (11.0.0.0/8)
* 12.0.0.0 - 12.255.255.255 (12.0.0.0/8)
* 13.0.0.0 - 13.255.255.255 (13.0.0.0/8)
* 14.0.0.0 - 14.255.255.255 (14.0.0.0/8)
* 15.0.0.0 - 15.255.255.255 (15.0.0.0/8)
* 16.0.0.0 - 16.255.255.255 (16.0.0.0/8)
* 17.0.0.0 - 17.255.255.255 (17.0.0.0/8)
* 18.0.0.0 - 18.255.255.255 (18.0.0.0/8)
* 19.0.0.0 - 19.255.255.255 (19.0.0.0/8)
* 20.0.0.0 - 20.255.255.255 (20.0.0.0/8)
* 21.0.0.0 - 21.255.255.255 (21.0.0.0/8)
* 22.0.0.0 - 22.255.255.255 (22.0.0.0/8)
* 23.0.0.0 - 23.255.255.255 (23.0.0.0/8)
* 24.0.0.0 - 24.255.255.255 (24.0.0.0/8)
* 25.0.0.0 - 25.255.255.255 (25.0.0.0/8)
* 26.0.0.0 - 26.255.255.255 (26.0.0.0/8)
* 27.0.0.0 - 27.255.255.255 (27.0.0.0/8)
* 28.0.0.0 - 28.255.255.255 (28.0.0.0/8)
* 29.0.0.0 - 29.255.255.255 (29.0.0.0/8)
* 30.0.0.0 - 30.255.255.255 (30.0.0.0/8)
* 31.0.0.0 - 31.255.255.255 (31.0.0.0/8)
* 32.0.0.0 - 32.255.255.255 (32.0.0.0/8)
* 33.0.0.0 - 33.255.255.255 (33.0.0.0/8)
* 34.0.0.0 - 34.255.255.255 (34.0.0.0/8)
* 35.0.0.0 - 35.255.255.255 (35.0.0.0/8)
* 36.0.0.0 - 36.255.255.255 (36.0.0.0/8)
* 37.0.0.0 - 37.255.255.255 (37.0.0.0/8)
* 38.0.0.0 - 38.255.255.255 (38.0.0.0/8)
* 39.0.0.0 - 39.255.255.255 (39.0.0.0/8)
* 40.0.0.0 - 40.255.255.255 (40.0.0.0/8)
* 41.0.0.0 - 41.255.255.255 (41.0.0.0/8)
* 42.0.0.0 - 42.255.255.255 (42.0.0.0/8)
* 43.0.0.0 - 43.255.255.255 (43.0.0.0/8)
* 44.0.0.0 - 44.255.255.255 (44.0.0.0/8)
* 45.0.0.0 - 45.255.255.255 (45.0.0.0/8)
* 46.0.0.0 - 46.255.255.255 (46.0.0.0/8)
* 47.0.0.0 - 47.255.255.255 (47.0.0.0/8)
* 48.0.0.0 - 48.255.255.255 (48.0.0.0/8)
* 49.0.0.0 - 49.255.255.255 (49.0.0.0/8)
* 50.0.0.0 - 50.255.255.255 (50.0.0.0/8)
* 51.0.0.0 - 51.255.255.255 (51.0.0.0/8)
* 52.0.0.0 - 52.255.255.255 (52.0.0.0/8)
* 53.0.0.0 - 53.255.255.255 (53.0.0.0/8)
* 54.0.0.0 - 54.255.255.255 (54.0.0.0/8)
* 55.0.0.0 - 55.255.255.255 (55.0.0.0/8)
* 56.0.0.0 - 56.255.255.255 (56.0.0.0/8)
* 57.0.0.0 - 57.255.255.255 (57.0.0.0/8)
* 58.0.0.0 - 58.255.255.255 (58.0.0.0/8)
* 59.0.0.0 - 59.255.255.255 (59.0.0.0/8)
* 60.0.0.0 - 60.255.255.255 (60.0.0.0/8)
* 61.0.0.0 - 61.255.255.255 (61.0.0.0/8)
* 62.0.0.0 - 62.255.255.255 (62.0.0.0/8)
* 63.0.0.0 - 63.255.255.255 (63.0.0.0/8)
* 64.0.0.0 - 64.255.255.255 (64.0.0.0/8)
* 65.0.0.0 - 65.255.255.255 (65.0.0.0/8)
* 66.0.0.0 - 66.255.255.255 (66.0.0.0/8)
* 67.0.0.0 - 67.255.255.255 (67.0.0.0/8)
* 68.0.0.0 - 68.255.255.255 (68.0.0.0/8)
* 69.0.0.0 - 69.255.255.255 (69.0.0.0/8)
* 70.0.0.0 - 70.255.255.255 (70.0.0.0/8)
* 71.0.0.0 - 71.255.255.255 (71.0.0.0/8)
* 72.0.0.0 - 72.255.255.255 (72.0.0.0/8)
* 73.0.0.0 - 73.255.255.255 (73.0.0.0/8)
* 74.0.0.0 - 74.255.255.255 (74.0.0.0/8)
* 75.0.0.0 - 75.255.255.255 (75.0.0.0/8)
* 76.0.0.0 - 76.255.255.255 (76.0.0.0/8)
* 77.0.0.0 - 77.255.255.255 (77.0.0.0/8)
* 78.0.0.0 - 78.255.255.255 (78.0.0.0/8)
* 79.0.0.0 - 79.255.255.255 (79.0.0.0/8)
* 80.0.0.0 - 80.255.255.255 (80.0.0.0/8)
* 81.0.0.0 - 81.255.255.255 (81.0.0.0/8)
* 82.0.0.0 - 82.255.255.255 (82.0.0.0/8)
* 83.0.0.0 - 83.255.255.255 (83.0.0.0/8)
* 84.0.0.0 - 84.255.255.255 (84.0.0.0/8)
* 85.0.0.0 - 85.255.255.255 (85.0.0.0/8)
* 86.0.0.0 - 86.255.255.255 (86.0.0.0/8)
* 87.0.0.0 - 87.255.255.255 (87.0.0.0/8)
* 88.0.0.0 - 88.255.255.255 (88.0.0.0/8)
* 89.0.0.0 - 89.255.255.255 (89.0.0.0/8)
* 90.0.0.0 - 90.255.255.255 (90.0.0.0/8)
* 91.0.0.0 - 91.255.255.255 (91.0.0.0/8)
* 92.0.0.0 - 92.255.255.255 (92.0.0.0/8)
* 93.0.0.0 - 93.255.255.255 (93.0.0.0/8)
* 94.0.0.0 - 94.255.255.255 (94.0.0.0/8)
* 95.0.0.0 - 95.255.255.255 (95.0.0.0/8)
* 96.0.0.0 - 96.255.255.255 (96.0.0.0/8)
* 97.0.0.0 - 97.255.255.255 (97.0.0.0/8)
* 98.0.0.0 - 98.255.255.255 (98.0.0.0/8)
* 99.0.0.0 - 99.255.255.255 (99.0.0.0/8)
* 100.0.0.0 - 100.255.255.255 (100.0.0.0/8)
* 101.0.0.0 - 101.255.255.255 (101.0.0.0/8)
* 102.0.0.0 - 102.255.255.255 (102.0.0.0/8)
* 103.0.0.0 - 103.255.255.255 (103.0.0.0/8)
* 104.0.0.0 - 104.255.255.255 (104.0.0.0/8)
* 105.0.0.0 - 105.255.255.255 (105.0.0.0/8)
* 106.0.0.0 - 106.255.255.255 (106.0.0.0/8)
* 107.0.0.0 - 107.255.255.255 (107.0.0.0/8)
* 108.0.0.0 - 108.255.255.255 (108.0.0.0/8)
* 109.0.0.0 - 109.255.255.255 (109.0.0.0/8)
* 110.0.0.0 - 110.255.255.255 (110.0.0.0/8)
* 111.0.0.0 - 111.255.255.255 (111.0.0.0/8)
* 112.0.0.0 - 112.255.255.255 (112.0.0.0/8)
* 113.0.0.0 - 113.255.255.255 (113.0.0.0/8)
* 114.0.0.0 - 114.255.255.255 (114.0.0.0/8)
* 115.0.0.0 - 115.255.255.255 (115.0.0.0/8)
* 116.0.0.0 - 116.255.255.255 (116.0.0.0/8)
* 117.0.0.0 - 117.255.255.255 (117.0.0.0/8)
* 118.0.0.0 - 118.255.255.255 (118.0.0.0/8)
* 119.0.0.0 - 119.255.255.255 (119.0.0.0/8)
* 120.0.0.0 - 120.255.255.255 (120.0.0.0/8)
* 121.0.0.0 - 121.255.255.255 (121.0.0.0/8)
* 122.0.0.0 - 122.255.255.255 (122.0.0.0/8)
* 123.0.0.0 - 123.255.255.255 (123.0.0.0/8)
* 124.0.0.0 - 124.255.255.255 (124.0.0.0/8)
* 125.0.0.0 - 125.255.255.255 (125.0.0.0/8)
* 126.0.0.0 - 126.255.255.255 (126.0.0.0/8)
* 127.0.0.0 - 127.255.255.255 (127.0.0.0/8)
* 128.0.0.0 - 128.255.255.255 (128.0.0.0/8)
* 129.0.0.0 - 129.255.255.255 (129.0.0.0/8)
* 130.0.0.0 - 130.255.255.255 (130.0.0.0/8)
* 131.0.0.0 - 131.255.255.255 (131.0.0.0/8)
* 132.0.0.0 - 132.255.255.255 (132.0.0.0/8)
* 133.0.0.0 - 133.255.255.255 (133.0.0.0/8)
* 134.0.0.0 - 134.255.255.255 (134.0.0.0/8)
* 135.0.0.0 - 135.255.255.255 (135.0.0.0/8)
* 136.0.0.0 - 136.255.255.255 (136.0.0.0/8)
* 137.0.0.0 - 137.255.255.255 (137.0.0.0/8)
* 138.0.0.0 - 138.255.255.255 (138.0.0.0/8)
* 139.0.0.0 - 139.255.255.255 (139.0.0.0/8)
* 140.0.0.0 - 140.255.255.255 (140.0.0.0/8)
* 141.0.0.0 - 141.255.255.255 (141.0.0.0/8)
* 142.0.0.0 - 142.255.255.255 (142.0.0.0/8)
* 143.0.0.0 - 143.255.255.255 (143.0.0.0/8)
* 144.0.0.0 - 144.255.255.255 (144.0.0.0/8)
* 145.0.0.0 - 145.255.255.255 (145.0.0.0/8)
* 146.0.0.0 - 146.255.255.255 (146.0.0.0/8)
* 147.0.0.0 - 147.255.255.255 (147.0.0.0/8)
* 148.0.0.0 - 148.255.255.255 (148.0.0.0/8)
* 149.0.0.0 - 149.255.255.255 (149.0.0.0/8)
* 150.0.0.0 - 150.255.255.255 (150.0.0.0/8)
* 151.0.0.0 - 151.255.255.255 (151.0.0.0/8)
* 152.0.0.0 - 152.255.255.255 (152.0.0.0/8)
* 153.0.0.0 - 153.255.255.255 (153.0.0.0/8)
* 154.0.0.0 - 154.255.255.255 (154.0.0.0/8)
* 155.0.0.0 - 155.255.255.255 (155.0.0.0/8)
* 156.0.0.0 - 156.255.255.255 (156.0.0.0/8)
* 157.0.0.0 - 157.255.255.255 (157.0.0.0/8)
* 158.0.0.0 - 158.255.255.255 (158.0.0.0/8)
* 159.0.0.0 - 159.255.255.255 (159.0.0.0/8)
* 160.0.0.0 - 160.255.255.255 (160.0.0.0/8)
* 161.0.0.0 - 161.255.255.255 (161.0.0.0/8)
* 162.0.0.0 - 162.255.255.255 (162.0.0.0/8)
* 163.0.0.0 - 163.255.255.255 (163.0.0.0/8)
* 164.0.0.0 - 164.255.255.255 (164.0.0.0/8)
* 165.0.0.0 - 165.255.255.255 (165.0.0.0/8)
* 166.0.0.0 - 166.255.255.255 (166.0.0.0/8)
* 167.0.0.0 - 167.255.255.255 (167.0.0.0/8)
* 168.0.0.0 - 168.255.255.255 (168.0.0.0/8)
* 169.0.0.0 - 169.255.255.255 (169.0.0.0/8)
* 170.0.0.0 - 170.255.255.255 (170.0.0.0/8)
* 171.0.0.0 - 171.255.255.255 (171.0.0.0/8)
* 172.0.0.0 - 172.255.255.255 (172.0.0.0/8)
* 173.0.0.0 - 173.255.255.255 (173.0.0.0/8)
* 174.0.0.0 - 174.255.255.255 (174.0.0.0/8)
* 175.0.0.0 - 175.255.255.255 (175.0.0.0/8)
* 176.0.0.0 - 176.255.255.255 (176.0.0.0/8)
* 177.0.0.0 - 177.255.255.255 (177.0.0.0/8)
* 178.0.0.0 - 178.255.255.255 (178.0.0.0/8)
* 179.0.0.0 - 179.255.255.255 (179.0.0.0/8)
* 180.0.0.0 - 180.255.255.255 (180.0.0.0/8)
* 181.0.0.0 - 181.255.255.255 (181.0.0.0/8)
* 182.0.0.0 - 182.255.255.255 (182.0.0.0/8)
* 183.0.0.0 - 183.255.255.255 (183.0.0.0/8)
* 184.0.0.0 - 184.255.255.255 (184.0.0.0/8)
* 185.0.0.0 - 185.255.255.255 (185.0.0.0/8)
* 186.0.0.0 - 186.255.255.255 (186.0.0.0/8)
* 187.0.0.0 - 187.255.255.255 (187.0.0.0/8)
* 188.0.0.0 - 188.255.255.255 (188.0.0.0/8)
* 189.0.0.0 - 189.255.255.255 (189.0.0.0/8)
* 190.0.0.0 - 190.255.255.255 (190.0.0.0/8)
* 191.0.0.0 - 191.255.255.255 (191.0.0.0/8)
* 192.0.0.0 - 192.255.255.255 (192.0.0.0/8)
* 193.0.0.0 - 193.255.255.255 (193.0.0.0/8)
* 194.0.0.0 - 194.255.255.255 (194.0.0.0/8)
* 195.0.0.0 - 195.255.255.255 (195.0.0.0/8)
* 196.0.0.0 - 196.255.255.255 (196.0.0.0/8)
* 197.0.0.0 - 197.255.255.255 (197.0.0.0/8)
* 198.0.0.0 - 198.255.255.255 (198.0.0.0/8)
* 199.0.0.0 - 199.255.255.255 (199.0.0.0/8)
* 200.0.0.0 - 200.255.255.255 (200.0.0.0/8)
* 201.0.0.0 - 201.255.255.255 (201.0.0.0/8)
* 202.0.0.0 - 202.255.255.255 (202.0.0.0/8)
* 203.0.0.0 - 203.255.255.255 (203.0.0.0/8)
* 204.0.0.0 - 204.255.255.255 (204.0.0.0/8)
* 205.0.0.0 - 205.255.255.255 (205.0.0.0/8)
* 206.0.0.0 - 206.255.255.255 (206.0.0.0/8)
* 207.0.0.0 - 207.255.255.255 (207.0.0.0/8)
* 208.0.0.0 - 208.255.255.255 (208.0.0.0/8)
* 209.0.0.0 - 209.255.255.255 (209.0.0.0/8)
* 210.0.0.0 - 210.255.255.255 (210.0.0.0/8)
* 211.0.0.0 - 211.255.255.255 (211.0.0.0/8)
* 212.0.0.0 - 212.255.255.255 (212.0.0.0/8)
* 213.0.0.0 - 213.255.255.255 (213.0.0.0/8)
* 214.0.0.0 - 214.255.255.255 (214.0.0.0/8)
* 215.0.0.0 - 215.255.255.255 (215.0.0.0/8)
* 216.0.0.0 - 216.255.255.255 (216.0.0.0/8)
* 217.0.0.0 - 217.255.255.255 (217.0.0.0/8)
* 218.0.0.0 - 218.255.255.255 (218.0.0.0/8)
* 219.0.0.0 - 219.255.255.255 (219.0.0.0/8)
* 220.0.0.0 - 220.255.255.255 (220.0.0.0/8)
* 221.0.0.0 - 221.255.255.255 (221.0.0.0/8)
* 222.0.0.0 - 222.255.255.255 (222.0.0.0/8)
* 223.0.0.0 - 223.255.255.255 (223.0.0.0/8)
* 224.0.0.0 - 224.255.255.255 (224.0.0.0/8)
* 225.0.0.0 - 225.255.255.255 (225.0.0.0/8)
* 226.0.0.0 - 226.255.255.255 (226.0.0.0/8)
* 227.0.0.0 - 227.255.255.255 (227.0.0.0/8)
* 228.0.0.0 - 228.255.255.255 (228.0.0.0/8)
* 229.0.0.0 - 229.255.255.255 (229.0.0.0/8)
* 230.0.0.0 - 230.255.255.255 (230.0.0.0/8)
* 231.0.0.0 - 231.255.255.255 (231.0.0.0/8)
* 232.0.0.0 - 232.255.255.255 (232.0.0.0/8)
* 233.0.0.0 - 233.255.255.255 (233.0.0.0/8)
* 234.0.0.0 - 234.255.255.255 (234.0.0.0/8)
* 235.0.0.0 - 235.255.255.255 (235.0.0.0/8)
* 236.0.0.0 - 236.255.255.255 (236.0.0.0/8)
* 237.0.0.0 - 237.255.255.255 (237.0.0.0/8)
* 238.0.0.0 - 238.255.255.255 (238.0.0.0/8)
* 239.0.0.0 - 239.255.255.255 (239.0.0.0/8)
* 240.0.0.0 - 240.255.255.255 (240.0.0.0/8)
* 241.0.0.0 - 241.255.255.255 (241.0.0.0/8)
* 242.0.0.0 - 242.255.255.255 (242.0.0.0/8)
* 243.0.0.0 - 243.255.255.255 (243.0.0.0/8)
* 244.0.0.0 - 244.255.255.255 (244.0.0.0/8)
* 245.0.0.0 - 245.255.255.255 (245.0.0.0/8)
* 246.0.0.0 - 246.255.255.255 (246.0.0.0/8)
* 247.0.0.0 - 247.255.255.255 (247.0.0.0/8)
* 248.0.0.0 - 248.255.255.255 (248.0.0.0/8)
* 249.0.0.0 - 249.255.255.255 (249.0.0.0/8)
* 250.0.0.0 - 250.255.255.255 (250.0.0.0/8)
* 251.0.0.0 - 251.255.255.255 (251.0.0.0/8)
* 252.0.0.0 - 252.255.255.255 (252.0.0.0/8)
* 253.0.0.0 - 253.255.255.255 (253.0.0.0/8)
* 254.0.0.0 - 254.255.255.255 (254.0.0.0/8)
* 255.0.0.0 - 255.255.255.255 (255.0.0.0/8)