Get hostname and Geo location
info for any IP



Whois Lookup
Get contact info for a domain/ip
Traceroute
Shows network route to host
Your iP is: 3.81.89.248 United States Near: Ashburn, Virginia, United States

This is where you are:

IP Information - 3.81.89.248

Host name: ec2-3-81-89-248.compute-1.amazonaws.com

Country: United States

Country Code: US

Region:

City:

Latitude: 37.751

Longitude: -97.822

Anonymous is reporting 45.135.233.149

This IP address, although destroyed at my Mickey Mouse Border controls, did attempt multiple port scans, failed miserably. Attempted to reconfigure DHCP, This you could say blew up back on their faces because of their lack of steady and stable electricity running cooling pumps using liquid in their Minnie Mouse Linux Tails machine running off a 32 GB thumb drive, with hidden data on it. I’ve assisted the usb storage device, by making all hidden and poorly formatted data, available, unencrypted, locked for their chewing pleasure, and send to to or maybe 3 or 6 entities. I think the international community has no issue having jurisdiction with full authority. Singapore Police were notified to pick up the locked usb drive in a local American Hotel. Even though these lovers think they are safe, a British Intelligence analyst was so gracious to unlock and post the young womens. Pics between 12-16 years of age all over and to the appropriate International Law Enforcement Agency. They are supposed to be good at finding people with live video and mic feeds less their appliance, software,along with a poor attempt to mimick Tor forgetting a minor detail. Don’t broadcast packets for hours at 3,500 MB on all ports. I am far from smart, you are stupid beyond 2000. I’m partial to the UK’s BBC News. I also enjoy the Technology section in the Guardian Newspaper. They broke Snowden and Stuxnet. I always appreciated their good work without hurting others, suck as that WikiPiss. It’s a tabloid but much worse. Btw, the Guardian will be onsite for your arrest Live Worldwide. All you had to do was stay away from I. Second, getting aroused by a young girl with the world ahead of her, having to deal with filthy diseased men using their photos, traumatize innocence. 2 things 3 consecutive sentiences. Btw, we won’t see you outside a cell in this world! Hope you feel bad. Hope you want to confess to an armed veteran Policemen . He will absolve you, I promise you that! The Guardian will play their inside info for all networks worldwide. Be careful , be healthy for trial. Fair is fair.

IP identified as: Hackers IP, Reported on: 4th, Dec. 2021
DevinLew is reporting 104.206.50.20

http://www.abgefuckt-liebt-dich.de/weiterleitung.php?url=https://gayspornx.com/categories/Vertical%20Video/ https://maps.gngjd.com/url?q=https://gayspornx.com/categories/Brunette/ http://www.hornymaturez.com/cgi-bin/at3/out.cgi?id=106&tag=top&trade=https://gayspornx.com/categories/Female%20Orgasm/ http://ftp.rudolf-steiner.org/jump.php?url=https://gayspornx.com/categories/Bisexual%20Male/ https://celog.am/en/1/Home/SetCulture?pageUrl=https://gayspornx.com/categories/Blowjob/

Reported on: 4th, Dec. 2021
Mahamed is reporting 197.231.201.205

Hsvebdh

IP identified as: Office IP, Reported on: 4th, Dec. 2021
LEMOINE is reporting 209.85.219.68

ENGLISH VERSION : RECEIPT again these same emails stolen French LA POSTE using ( again ) emails boxes and IP Address of Society GOOGLE FRANÇAIS : RECEPTION nombreux emails d'escroqueries aux faux colis (non) livrés usurpant ENCORE LA POSTE en France avec adresse emails Google bidons ( ou volées ) en Gmail.com : Bonjour Webmasters de LAPOSTE.net, SIGNAL SPAM, Signal-Arnaques.com, et GOOGLE et alertespam@labanquepostale.fr , et abuse@google.com abuse@gmail.com et abuse@ripe.net et network-abuse@google.com arin-contact@google.com Et celà continue encore en Décembre 2021 et ceci depuis au moins +15 années ( emails tous archivés complets avec tous leurs codes HTML depuis 2007 )( il y a forcément des complicités, du laxisme, des incompétents d’Etats et Services Administratifs chez des fournisseurs d’accès, depuis toutes ces +15 années que celà dure ! Ces escrocs ont vraiment la belle vie pour sévir en France ! Ce Vendredi 03 Décembre 2021 après 22h01 ( et très souvent les week-ends, ou très souvent aussi les nuits, avant ou après les horaires des Bureaux et Administrations en France, méthodes de faux-culs et d’escrocs ) j'ai encore reçu sur ma boite email ce même email d’escroqueries avec faux contenu de LAPOSTE et venant de l'adresse email GMAIL bidon ou usurpée,volée : guelsayouba@gmail.com Les adresses IP utilisées par le PC ou Smartphone de ce(s) batards de hackers fous, débiles, têtus, butés, et analphabètes ( incapables d’écrire correctement le Français depuis + 15 années ) sont multiples pour brouiller les pistes : 209.85.219.68 chez Google aux USA Received : from mail-qv1-f68.google.com (mail-qv1-f68.google.com [209.85.219.68]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by mlpnf0115.laposte.net (SMTP Server) with ESMTPS id 4J5QHP2SbRzvPrL for <@laposte.net>; Fri, 3 Dec 2021 22:01:53 +0100 (CET) Received : by mail-qv1-f68.google.com with SMTP id p3so3970399qvj.9 for <@laposte.net>; Fri, 03 Dec 2021 13:01:53 -0800 (PST) DKIM-Signature : v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20210112; h=mime-version:from:date:message-id:subject:to; bh=nd0wq5F0XWFG5H7kdRG5RQDFewV86zO+COFKfv+LwoA=; IP Lookup Details: IP Information - 209.85.219.68 Host name: mail-qv1-f68.google.com Country: United States Country Code: US Region: City: Latitude: 37.751 Longitude: -97.822 utilisant ENCORE les boites emails de la Société Google et les serveurs IP de ces Sociétés. C'est visiblement et clairement une tentative de phishing et fraude ( fautes de grammaire multiples ) Ci-dessous cet email d’escroquerie avec ces en-têtes complets : *********** CONTENU du mail d’escroquerie *************** Laposte • vendredi 3 Décembre, 22:01 (il y a 10 heures) 58Ko • • • De : ...WEB... • A : mail@laposte.net • Utilisateurs de compte laposte, Vos données seront supprimés dans quelques heures Pour annuler l'opération cliquez sur : Annulation Laposte vous remercie UNE QUESTION ? VOS RÉPONSES ICI. LAPOSTE & Moi Espace client Par téléphone au Je me rends dans la boutique LAPOSTE la plus proche À BIENTÔT SUR LAPOSTE .FR ****************** Codes HTML complets ci-dessous *********************** Return-Path : <guelsayouba@gmail.com> Received : from mlpnf0115.laposte.net (mlpnf0115.sys.meshcore.net [10.94.128.94]) by mlpnb0108 with LMTPA; Fri, 03 Dec 2021 22:01:53 +0100 X-Cyrus-Session-Id : cyrus-81887-1638565313-3-2229991705310562620 X-Sieve : CMU Sieve 3.0 X-mail-filterd : {"version":"1.3.4","queueID":"4J5QHP5VzGzvPrD","contextId":"452b9d11-9bed-466a-bf98-eee1f0d58456"} X-ppbforward : {"queueID":"4J5QHP5VzGzvPrD","server":"mlpnf0115"} Received : from outgoing-mail.laposte.net (localhost.localdomain [127.0.0.1]) by mlpnf0115.laposte.net (SMTP Server) with ESMTP id 4J5QHP5VzGzvPrD for <lpn000000000000000018870443@back01-mail02-04.lpn.svc.meshcore.net>; Fri, 3 Dec 2021 22:01:53 +0100 (CET) X-mail-filterd : {"version":"1.3.4","queueID":"4J5QHP2SbRzvPrL","contextId":"ec1532fb-5c21-4fe3-8864-34c262b7afc6"} X-lpn-mailing : LEGIT X-lpn-spamrating : 55 X-lpn-spamlevel : not-spam Authentication-Results : laposte.net; spf=pass smtp.mailfrom=guelsayouba@gmail.com smtp.helo=mail-qv1-f68.google.com; dkim=pass reason="good signature" header.d=gmail.com header.s=20210112 header.b=M6m/Fu; dmarc=pass reason="SPF is aligned, DKIM is aligned" X-lpn-spamcause : OK, (75)(0000)gggruggvucftvghtrhhoucdtuddrgedvuddrieejgddugeejucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecunfetrffquffvgfdpggftfghnshhusghstghrihgsvgenuceurghilhhouhhtmecufedttdenucgoufhushhpvggtthffohhmrghinhculdegledmnegovfhrrggtvgdqnffrucdluddmnegorfgvrhhiohgushetthfgnhguqfhftehlihgrshculddvhedmnecujfgurhepggfhfffkuffvtgesrgdtreertddtjeenucfhrhhomhepfddrrddrhgfguedrrddrfdcuoehguhgvlhhsrgihohhusggrsehgmhgrihhlrdgtohhmqeenucggtffrrghtthgvrhhnpeduvdeufeeugfeuhffggfefveejkeelleejfeffieefgfeuhfffhffhheejudeuhfenucffohhmrghinhepsghithdrlhihnecukfhppedvtdelrdekhedrvdduledrieeknecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepvddtledrkeehrddvudelrdeikedphhgvlhhopehmrghilhdqqhhvuddqfheikedrghhoohhglhgvrdgtohhmpdhmrghilhhfrhhomhepghhuvghlshgrhihouhgsrgesghhmrghilhdrtghomhdprhgtphhtthhopegvlhgvrdhlvghmohhinhgvsehlrghpohhsthgvrdhnvghtpdhsphhfpehprghsshdpughkihhmpehprghsshdpughmrghrtgepphgrshhs Received : from mail-qv1-f68.google.com (mail-qv1-f68.google.com [209.85.219.68]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by mlpnf0115.laposte.net (SMTP Server) with ESMTPS id 4J5QHP2SbRzvPrL for <ele.lemoine@laposte.net>; Fri, 3 Dec 2021 22:01:53 +0100 (CET) Received : by mail-qv1-f68.google.com with SMTP id p3so3970399qvj.9 for <ele.lemoine@laposte.net>; Fri, 03 Dec 2021 13:01:53 -0800 (PST) DKIM-Signature : v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20210112; h=mime-version:from:date:message-id:subject:to; bh=nd0wq5F0XWFG5H7kdRG5RQDFewV86zO+COFKfv+LwoA=; b=M6m/FuCG9u6aY/0pivEXE7Z6/hTSRFsfyd34OjOnPRQzkz3Gf8tLaxgLiv36cjEhdZ sPrza7ls0hUNN/4WExFDxlk703gjF14WsoyWPy6mT+DPdnQ/sGzDyRHPiAfcg2RCvNqu /r7pC/yX4FsjxK0dytq9Itn7weP2XHdu6NQ60nWq51moCAIpFxARegmCOzPkO5rTDtb/ txk1STkBgeCMdDKUaFs5Td8oGuO2jfv/1T1Ba3znca6PNZOu+/1/W++geVpX2dCyQEIV yxxUbmXqgUeBG9jvpi24tQGxrpR4oGkJqfXp+7FPsl0I0ZucfEgyyOy4eFjFdhnH0SpO lFxg== X-Google-DKIM-Signature : v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20210112; h=x-gm-message-state:mime-version:from:date:message-id:subject:to; bh=nd0wq5F0XWFG5H7kdRG5RQDFewV86zO+COFKfv+LwoA=; b=G8vQbJkzPuKCuDkkBnAc+7HityWKxsRjAPYB9kgSK6Gqzyy1HHTYapK97EeOcwwJRu M3dr/D9NDYsmwGzjKQytatS22pLTzHSLRoSXNzjNNfGyyT2t3nC160lDsKGJ24u137De GF8qH3Zg0u2l1x2L4+Fp3jZ+cFPQ4q9uHdpyhe+q2cbEfEc43m9h6Y3bTCaEQJWTeFbR Ljn+V5LLMZcV6a2thdyNXOb60Hk+NrJIgv9CAJA12xZqX/rHingKnkhsQuQxwpetUifX MykoGtlvdh0KQCu6wWyCCRrskBMaSNyuHMx+OqncNOQ2dJeBuR+Z4o0migVF9w9PEEAk KszQ== X-Gm-Message-State : AOAM531uOjBy/bS4zs3EOt7kjzqtnhtE+QnJQYyAbhz1JxDoTethqhbg Z7kg6XG2pdu+ChCHLGbNJHwEThJteL07Q5iCZ78R9ECQmloInA== X-Google-Smtp-Source : ABdhPJwdGunNK3sq8EBoBPT4QIAGHA6/VsPWsyPFSfXSwJ51w/Sa4+VRDJZI9xcmPe47K2WCNoJIjnv+wRcHPmCYe4E= X-Received : by 2002:a67:edd7:: with SMTP id e23mr23277532vsp.52.1638559034624; Fri, 03 Dec 2021 11:17:14 -0800 (PST) MIME-Version : 1.0 From : "...WEB..." <guelsayouba@gmail.com> Date : Fri, 3 Dec 2021 20:17:01 +0100 Message-ID : <CABpJ=cNTUxQNOAv95=br-F0XLztStWbh76+wf=s1YvLRpN=KbQ@mail.gmail.com> Subject : Laposte To : mail@laposte.net Content-Type : multipart/alternative; boundary="00000000000033cd1905d242c1bb"

IP identified as: Hackers IP, Reported on: 4th, Dec. 2021
R Brummer is reporting 172.58.197.75

A request to change my Facebook password originated from this IP.

IP identified as: Mobile device IP, Reported on: 4th, Dec. 2021
ronald wittman is reporting 165.230.129.42

fake stealing my info taking my money

IP identified as: Hackers IP, Reported on: 3rd, Dec. 2021
DevinLew is reporting 104.206.50.20

http://icons.showingtime.com/rd/RD?c=REALTORCOM&s=FMREALTY&url=malexnxx.com%2Fcategories%2FMuscle%2F http://m.shopinsanfran.com/redirect.aspx?url=https://malexnxx.com/categories/Masturbation/ http://sih.infoscan.info/__media__/js/netsoltrademark.php?d=malexnxx.com%2Fcategories%2FStraight%2520Guys%2F http://www.americancable.us/__media__/js/netsoltrademark.php?d=malexnxx.com%2Fcategories%2FStep%2520Fantasy%2F http://www.teachingengine.net/__media__/js/netsoltrademark.php?d=malexnxx.com%2Fcategories%2FMasturbation%2F

Reported on: 3rd, Dec. 2021
DevinLew is reporting 104.206.50.20

https://www.narasmachinery.com/dildegistir.php?dil=5&url=https://frootysales.com/ashampoo-movie-shrink-and-burn-4/ - bueoemsoftware https://designstore.ru/bitrix/redirect.php?goto=https://frootysales.com/embarcadero-rad-studio-2010-2-tokyo-architect/ - buy cheap oem software online http://pskprofy.ru/bitrix/rk.php?goto=https://frootysales.com/autodesk-revit-structure-2015/ - buy oem software online http://industrialautomationhq.com/__media__/js/netsoltrademark.php?d=frootysales.com%2Frosetta-stone-learn-english-british-level-1-2-3-4-and-5-set%2F - software online store http://fumettietorie.it/__media__/js/netsoltrademark.php?d=frootysales.com%2Fluxion-keyshot-6%2F - oem software cheap http://stablz.com/__media__/js/netsoltrademark.php?d=frootysales.com%2Fspi-sheetmetalworks-2016%2F - online purchasing software http://www.cresme.com/click.aspx?url=https://frootysales.com/adobe-incopy-cc-2015/ - online store software

Reported on: 3rd, Dec. 2021
Gladyship is reporting /lookup_whois.php

http://lauradayliving.com/redirect.php?to=https://good-answers.net/are-hydrangeas-bad-luck http://svadba.eventnn.ru/redir.php?link=https://catsndogs-answers.com/10152-are-basset-hounds-territorial.html https://movil.todorelatos.com/url.php?q=https://good-answers.net/did-red-pollard-ride-seabiscuit-again-after-his-injury https://catsndogs-answers.com/8852-are-american-pit-bulls-good-family-dogs.html https://good-answers.net/does-adhd-qualify-for-emotional-support-dog https://dowclub.net/how-big-are-cross-stitch-squares/ https://dowclub.net/what-did-interchangeable-parts-do/ https://catsndogs-answers.com/8471-are-all-west-highland-terriers-white.html

Reported on: 3rd, Dec. 2021
GilbertDremy is reporting /lookup_whois.php

check my site https://progearph.com/ita/slimming/oxyslim/

Reported on: 3rd, Dec. 2021
HowardSed is reporting /lookup_whois.php

browse this site https://shopnaturgoods.com/slimming/dietonus/

Reported on: 3rd, Dec. 2021
Diabate is reporting 51.81.33.155

Very

IP identified as: Hackers IP, Reported on: 2nd, Dec. 2021
Troy is reporting 98.250.15.140

98.250.15.140 is hacker's ip address

IP identified as: Hackers IP, Reported on: 2nd, Dec. 2021
DanielSconi is reporting /lookup_whois.php

Read Full Article https://pharmfriend.site/deu/flexumgel/

Reported on: 2nd, Dec. 2021
DavidGew is reporting /lookup_whois.php

published here https://shopluckyonline.com/intenskin/

Reported on: 2nd, Dec. 2021
12022021 is reporting 216.134.221.22

checking server

IP identified as: Wireless IP, Reported on: 2nd, Dec. 2021
DevinLew is reporting 104.206.50.20

http://maps.google.co.nz/url?sa=t&url=http%3A%2F%2Fbestpublicsextube.com http://www.emptycage.com/__media__/js/netsoltrademark.php?d=livebdsmtube.com http://puppypal.com/__media__/js/netsoltrademark.php?d=bestoftwink.com http://www.mundoargentina.org/__media__/js/netsoltrademark.php?d=daddy.thepornobest.com http://perasonvue.com/__media__/js/netsoltrademark.php?d=1sex.us https://chaturbate.com/external_link/?url=https://livebdsmtube.com http://www.szpak.biz/__media__/js/netsoltrademark.php?d=cams.gaymoviescollection.com http://splice1.org/__media__/js/netsoltrademark.php?d=xxxubevideo.com http://midway-park.com/__media__/js/netsoltrademark.php?d=xxxxez.com http://brookman.biz/__media__/js/netsoltrademark.php?d=gayupornotube.com

Reported on: 2nd, Dec. 2021
Frankbex is reporting /lookup_whois.php

dfdfdf

Reported on: 2nd, Dec. 2021
Anthonywes is reporting /lookup_whois.php

NEW Music Techno, Tech House, Minimal: https://techno-summer.blogspot.com RNB,Promo Only,Albums: https://classicalrnb.blogspot.com Music Scene Label Records: https://scenelabels.blogspot.com/ 0day Trance: https://trance2019.blogspot.com/ Old School Music, Industrial: https://electro1990.blogspot.com/ Reggae FLAC: https://reggaenfo.blogspot.com Music Metal Albums: https://deatmetalmaniac.blogspot.com 0day Music Releases: https://0dayzmp3.blogspot.com FTP service is a community for DJ’s & fans that helps you gain full access to exclusive electronic music. Main target of our service is to show the world new upcoming talents as well as famous producers, populations of music culture, promotion of perspective projects. Best Regards, Francis

Reported on: 2nd, Dec. 2021
Ben is reporting 198.134.107.195

Attempted DDoS and bot traffic

IP identified as: Spammers IP, Reported on: 1st, Dec. 2021
94.26.221.232 is reporting 94.26.221.232

94.26.221.232

IP identified as: , Reported on: 1st, Dec. 2021
94.26.221.232 is reporting 94.26.221.232

94.26.221.232

IP identified as: غير متاح, Reported on: 1st, Dec. 2021
Christine is reporting 199.115.192.33

This person hacked in my internet. What can I do about this. I’m tired of it

IP identified as: Hackers IP, Reported on: 1st, Dec. 2021
LEMOINE is reporting 87.251.84.79

RECEIPT emails Phishings from bad, crazy, wrong Erotica Website ( classed X ) from RUSSIA, IP Address of these bastards crazy Hackers : 87.251.84.79 in RUSSIA RECEPTION emails d’escroqueries érotiques, de Phishings, venant encore de RUSSIE : Bonjour Webmasters de LAPOSTE.net, SIGNAL SPAM, Signal-Arnaques.com, Google.com, et abuse@ripe.net et hostmaster@ripe.net Et celà continue encore en Décembre 2021 et ceci depuis au moins +15 années ( emails tous archivés complets avec tous leurs codes HTML depuis 2007 )( il y a forcément des complicités, du laxisme, des incompétents d’Etats et Services Administratifs chez des fournisseurs d’accès, depuis toutes ces +15 années que celà dure ! Ces escrocs ont la belle vie pour sévir en FRANCE ! Cette nuit de Mardi 30 Novembre 2021 après 20h55 ( et aussi très souvent les week-ends, très souvent donc les nuits, avant ou après les horaires des Bureaux et Administrations en France, méthodes de faux-culs et d’escrocs ) j'ai aussi reçu sur ma boite email, cet email d’escroqueries, de phishings érotiques, et venant de l'adresse RUSSE bidon : info@posydov.ru Les adresses IP utilisées par le PC de ce(s) batards de hackers fous, débiles, têtus, butés, et analphabètes ( incapables d’écrire correctement le Français depuis + 15 années ) en cause sont: 87.251.84.79 en RUSSIE Received : from posydov.ru (unknown [87.251.84.79]) by mlpnf0103.laposte.net (SMTP Server) with ESMTP id 4J3XyG4g4bz7t7Z for <@laposte.net>; Tue, 30 Nov 2021 20:55:34 +0100 (CET) DKIM-Signature : v=1; a=rsa-sha256; c=relaxed/relaxed; s=dkim5; d=posydov.ru; h=Message-ID:Date:Subject:From:Reply-To:To:MIME-Version:Content-Type; i=info@posydov.ru; IP Lookup Details: IP Information - 87.251.84.79 Host name: boncar.ru Country: Russian Federation Country Code: RU Region: City: Latitude: 55.7386 Longitude: 37.6068 Utilisant encore des boites emails posydov.fr **************************************************** Contenu de cet email : Tu me manques... • mardi 30 Novembre, 20:55 (il y a 12 heures) 7Ko • • • De : Hélène Dumais • A : ele.lemoine@laposte.net • Salut! Je ne veux pas être seule ce soir, s'il te plaît, envoie-moi un texto ici 💙💙💙 ***************** Codes HTML ci-dessous ******************* Return-Path : <info@posydov.ru> Received : from mlpnf0103.laposte.net (mlpnf0103.sys.meshcore.net [10.94.128.82]) by mlpnb0108 with LMTPA; Tue, 30 Nov 2021 20:55:34 +0100 X-Cyrus-Session-Id : cyrus-200928-1638302134-1-11219461562815449252 X-Sieve : CMU Sieve 3.0 X-mail-filterd : {"version":"1.3.4","queueID":"4J3XyG6H62z7t80","contextId":"fdb07bb8-8932-4f30-b56d-0e3303f1cba6"} X-ppbforward : {"queueID":"4J3XyG6H62z7t80","server":"mlpnf0103"} Received : from outgoing-mail.laposte.net (localhost.localdomain [127.0.0.1]) by mlpnf0103.laposte.net (SMTP Server) with ESMTP id 4J3XyG6H62z7t80 for <lpn000000000000000018870443@back01-mail02-04.lpn.svc.meshcore.net>; Tue, 30 Nov 2021 20:55:34 +0100 (CET) X-mail-filterd : {"version":"1.3.4","queueID":"4J3XyG4g4bz7t7Z","contextId":"ac2b1d64-43b4-41c5-8f73-9a2970981a33"} X-lpn-mailing : LEGIT X-lpn-spamrating : 40 X-lpn-spamlevel : not-spam Authentication-Results : laposte.net; spf=pass smtp.mailfrom=info@posydov.ru smtp.helo=posydov.ru; dkim=pass reason="good signature" header.d=posydov.ru header.i=info@posydov.ru header.s=dkim5 header.b=hL8OpC; dmarc=pass reason="SPF is aligned, DKIM is aligned" X-lpn-spamcause : OK, (0)(0000)gggruggvucftvghtrhhoucdtuddrgedvuddriedugddufeduucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecunfetrffquffvgfdpggftfghnshhusghstghrihgsvgenuceurghilhhouhhtmecufedttdenucenucfjughrpefkfffuhfhrvfggtgigofesrgdtjhhtkfdtjeenucfhrhhomhepjforlhoqnhgvucffuhhmrghishcuoehinhhfohesphhoshihughovhdrrhhuqeenucggtffrrghtthgvrhhnpeeiueeileehieffieeuffduuedvhfetgfevgedtheeuffdvgeeivedvjedthffgfeenucffohhmrghinhepphhoshihughovhdrrhhunecukfhppeekjedrvdehuddrkeegrdejleenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeekjedrvdehuddrkeegrdejledphhgvlhhopehpohhshiguohhvrdhruhdpmhgrihhlfhhrohhmpehinhhfohesphhoshihughovhdrrhhupdhrtghpthhtohepvghlvgdrlhgvmhhoihhnvgeslhgrphhoshhtvgdrnhgvthdpshhpfhepphgrshhspdgukhhimhepphgrshhspdgumhgrrhgtpehprghssh Received : from posydov.ru (unknown [87.251.84.79]) by mlpnf0103.laposte.net (SMTP Server) with ESMTP id 4J3XyG4g4bz7t7Z for <ele.lemoine@laposte.net>; Tue, 30 Nov 2021 20:55:34 +0100 (CET) DKIM-Signature : v=1; a=rsa-sha256; c=relaxed/relaxed; s=dkim5; d=posydov.ru; h=Message-ID:Date:Subject:From:Reply-To:To:MIME-Version:Content-Type; i=info@posydov.ru; bh=eUn+mq9WyLsSP22W/htp1ibECskk/aDbO2HpYdUksgI=; b=hL8OpC7PjMHlxJFCKJyxJgusES9rzLHWGlbP6zlQZdIbe/w5MfuAmt7SvY8ao/seGwk51vpR0BD2 u06DAgEk4c+ACUdBoEDbSwp3QRs8V0A+ppNJcBldvhkGe1EuEwGOpW1wFS0m3MHHjvdrIpb0TjNE 51OAPVl7Vfmy/cT1e2QS+TENzVxt6bERP70212Mmntk9U2URZaZUiqbzi1LkiNfRQXKt6/DHjeVb wwIKP28ym5paQCir1wYCC4yHFwtQhR9qcGHoZ/ZW3P8IgJ1KAXHB1WkEdmt3RO4WL3m4Rbg51XQG ia87q5rBXqTxfFXGOQem5y2r9FtnJKFFqx+Syg== Message-ID : <ddc1ffb9cd3be17537724a1eb32f2f66@posydov.ru> Date : Tue, 30 Nov 2021 19:28:00 +0000 Subject : Tu me manques... From : Hélène Dumais <info@posydov.ru> Reply-To : Hélène Dumais <admin@mail.com> To : "ele.lemoine@laposte.net" <ele.lemoine@laposte.net> MIME-Version : 1.0 Content-Type : multipart/alternative; boundary="_=_swift_v4_1638300480_1e3812d0f04150d7eef27ce1ed1dd723_=_" X-Sender : info@posydov.ru X-Receiver : ele.lemoine@laposte.net X-Mailer : Ximian Evolution 1.0.3 (1.0.3-6) Feedback-ID : zz3883mqx9cf4:ap7094dmh9442:hc1403shf2535:ad042gljdtfef

IP identified as: Hackers IP, Reported on: 1st, Dec. 2021
Anonymous is reporting 173.16.7.249

sending spam

IP identified as: Spammers IP, Reported on: 30th, Nov. 2021
 1 2 3 4 5 6 7 8 9 10 11 Next 
List of Class A IP ranges (click to view)
* 1.0.0.0 - 1.255.255.255 (1.0.0.0/8)
* 2.0.0.0 - 2.255.255.255 (2.0.0.0/8)
* 3.0.0.0 - 3.255.255.255 (3.0.0.0/8)
* 4.0.0.0 - 4.255.255.255 (4.0.0.0/8)
* 5.0.0.0 - 5.255.255.255 (5.0.0.0/8)
* 6.0.0.0 - 6.255.255.255 (6.0.0.0/8)
* 7.0.0.0 - 7.255.255.255 (7.0.0.0/8)
* 8.0.0.0 - 8.255.255.255 (8.0.0.0/8)
* 9.0.0.0 - 9.255.255.255 (9.0.0.0/8)
* 10.0.0.0 - 10.255.255.255 (10.0.0.0/8)
* 11.0.0.0 - 11.255.255.255 (11.0.0.0/8)
* 12.0.0.0 - 12.255.255.255 (12.0.0.0/8)
* 13.0.0.0 - 13.255.255.255 (13.0.0.0/8)
* 14.0.0.0 - 14.255.255.255 (14.0.0.0/8)
* 15.0.0.0 - 15.255.255.255 (15.0.0.0/8)
* 16.0.0.0 - 16.255.255.255 (16.0.0.0/8)
* 17.0.0.0 - 17.255.255.255 (17.0.0.0/8)
* 18.0.0.0 - 18.255.255.255 (18.0.0.0/8)
* 19.0.0.0 - 19.255.255.255 (19.0.0.0/8)
* 20.0.0.0 - 20.255.255.255 (20.0.0.0/8)
* 21.0.0.0 - 21.255.255.255 (21.0.0.0/8)
* 22.0.0.0 - 22.255.255.255 (22.0.0.0/8)
* 23.0.0.0 - 23.255.255.255 (23.0.0.0/8)
* 24.0.0.0 - 24.255.255.255 (24.0.0.0/8)
* 25.0.0.0 - 25.255.255.255 (25.0.0.0/8)
* 26.0.0.0 - 26.255.255.255 (26.0.0.0/8)
* 27.0.0.0 - 27.255.255.255 (27.0.0.0/8)
* 28.0.0.0 - 28.255.255.255 (28.0.0.0/8)
* 29.0.0.0 - 29.255.255.255 (29.0.0.0/8)
* 30.0.0.0 - 30.255.255.255 (30.0.0.0/8)
* 31.0.0.0 - 31.255.255.255 (31.0.0.0/8)
* 32.0.0.0 - 32.255.255.255 (32.0.0.0/8)
* 33.0.0.0 - 33.255.255.255 (33.0.0.0/8)
* 34.0.0.0 - 34.255.255.255 (34.0.0.0/8)
* 35.0.0.0 - 35.255.255.255 (35.0.0.0/8)
* 36.0.0.0 - 36.255.255.255 (36.0.0.0/8)
* 37.0.0.0 - 37.255.255.255 (37.0.0.0/8)
* 38.0.0.0 - 38.255.255.255 (38.0.0.0/8)
* 39.0.0.0 - 39.255.255.255 (39.0.0.0/8)
* 40.0.0.0 - 40.255.255.255 (40.0.0.0/8)
* 41.0.0.0 - 41.255.255.255 (41.0.0.0/8)
* 42.0.0.0 - 42.255.255.255 (42.0.0.0/8)
* 43.0.0.0 - 43.255.255.255 (43.0.0.0/8)
* 44.0.0.0 - 44.255.255.255 (44.0.0.0/8)
* 45.0.0.0 - 45.255.255.255 (45.0.0.0/8)
* 46.0.0.0 - 46.255.255.255 (46.0.0.0/8)
* 47.0.0.0 - 47.255.255.255 (47.0.0.0/8)
* 48.0.0.0 - 48.255.255.255 (48.0.0.0/8)
* 49.0.0.0 - 49.255.255.255 (49.0.0.0/8)
* 50.0.0.0 - 50.255.255.255 (50.0.0.0/8)
* 51.0.0.0 - 51.255.255.255 (51.0.0.0/8)
* 52.0.0.0 - 52.255.255.255 (52.0.0.0/8)
* 53.0.0.0 - 53.255.255.255 (53.0.0.0/8)
* 54.0.0.0 - 54.255.255.255 (54.0.0.0/8)
* 55.0.0.0 - 55.255.255.255 (55.0.0.0/8)
* 56.0.0.0 - 56.255.255.255 (56.0.0.0/8)
* 57.0.0.0 - 57.255.255.255 (57.0.0.0/8)
* 58.0.0.0 - 58.255.255.255 (58.0.0.0/8)
* 59.0.0.0 - 59.255.255.255 (59.0.0.0/8)
* 60.0.0.0 - 60.255.255.255 (60.0.0.0/8)
* 61.0.0.0 - 61.255.255.255 (61.0.0.0/8)
* 62.0.0.0 - 62.255.255.255 (62.0.0.0/8)
* 63.0.0.0 - 63.255.255.255 (63.0.0.0/8)
* 64.0.0.0 - 64.255.255.255 (64.0.0.0/8)
* 65.0.0.0 - 65.255.255.255 (65.0.0.0/8)
* 66.0.0.0 - 66.255.255.255 (66.0.0.0/8)
* 67.0.0.0 - 67.255.255.255 (67.0.0.0/8)
* 68.0.0.0 - 68.255.255.255 (68.0.0.0/8)
* 69.0.0.0 - 69.255.255.255 (69.0.0.0/8)
* 70.0.0.0 - 70.255.255.255 (70.0.0.0/8)
* 71.0.0.0 - 71.255.255.255 (71.0.0.0/8)
* 72.0.0.0 - 72.255.255.255 (72.0.0.0/8)
* 73.0.0.0 - 73.255.255.255 (73.0.0.0/8)
* 74.0.0.0 - 74.255.255.255 (74.0.0.0/8)
* 75.0.0.0 - 75.255.255.255 (75.0.0.0/8)
* 76.0.0.0 - 76.255.255.255 (76.0.0.0/8)
* 77.0.0.0 - 77.255.255.255 (77.0.0.0/8)
* 78.0.0.0 - 78.255.255.255 (78.0.0.0/8)
* 79.0.0.0 - 79.255.255.255 (79.0.0.0/8)
* 80.0.0.0 - 80.255.255.255 (80.0.0.0/8)
* 81.0.0.0 - 81.255.255.255 (81.0.0.0/8)
* 82.0.0.0 - 82.255.255.255 (82.0.0.0/8)
* 83.0.0.0 - 83.255.255.255 (83.0.0.0/8)
* 84.0.0.0 - 84.255.255.255 (84.0.0.0/8)
* 85.0.0.0 - 85.255.255.255 (85.0.0.0/8)
* 86.0.0.0 - 86.255.255.255 (86.0.0.0/8)
* 87.0.0.0 - 87.255.255.255 (87.0.0.0/8)
* 88.0.0.0 - 88.255.255.255 (88.0.0.0/8)
* 89.0.0.0 - 89.255.255.255 (89.0.0.0/8)
* 90.0.0.0 - 90.255.255.255 (90.0.0.0/8)
* 91.0.0.0 - 91.255.255.255 (91.0.0.0/8)
* 92.0.0.0 - 92.255.255.255 (92.0.0.0/8)
* 93.0.0.0 - 93.255.255.255 (93.0.0.0/8)
* 94.0.0.0 - 94.255.255.255 (94.0.0.0/8)
* 95.0.0.0 - 95.255.255.255 (95.0.0.0/8)
* 96.0.0.0 - 96.255.255.255 (96.0.0.0/8)
* 97.0.0.0 - 97.255.255.255 (97.0.0.0/8)
* 98.0.0.0 - 98.255.255.255 (98.0.0.0/8)
* 99.0.0.0 - 99.255.255.255 (99.0.0.0/8)
* 100.0.0.0 - 100.255.255.255 (100.0.0.0/8)
* 101.0.0.0 - 101.255.255.255 (101.0.0.0/8)
* 102.0.0.0 - 102.255.255.255 (102.0.0.0/8)
* 103.0.0.0 - 103.255.255.255 (103.0.0.0/8)
* 104.0.0.0 - 104.255.255.255 (104.0.0.0/8)
* 105.0.0.0 - 105.255.255.255 (105.0.0.0/8)
* 106.0.0.0 - 106.255.255.255 (106.0.0.0/8)
* 107.0.0.0 - 107.255.255.255 (107.0.0.0/8)
* 108.0.0.0 - 108.255.255.255 (108.0.0.0/8)
* 109.0.0.0 - 109.255.255.255 (109.0.0.0/8)
* 110.0.0.0 - 110.255.255.255 (110.0.0.0/8)
* 111.0.0.0 - 111.255.255.255 (111.0.0.0/8)
* 112.0.0.0 - 112.255.255.255 (112.0.0.0/8)
* 113.0.0.0 - 113.255.255.255 (113.0.0.0/8)
* 114.0.0.0 - 114.255.255.255 (114.0.0.0/8)
* 115.0.0.0 - 115.255.255.255 (115.0.0.0/8)
* 116.0.0.0 - 116.255.255.255 (116.0.0.0/8)
* 117.0.0.0 - 117.255.255.255 (117.0.0.0/8)
* 118.0.0.0 - 118.255.255.255 (118.0.0.0/8)
* 119.0.0.0 - 119.255.255.255 (119.0.0.0/8)
* 120.0.0.0 - 120.255.255.255 (120.0.0.0/8)
* 121.0.0.0 - 121.255.255.255 (121.0.0.0/8)
* 122.0.0.0 - 122.255.255.255 (122.0.0.0/8)
* 123.0.0.0 - 123.255.255.255 (123.0.0.0/8)
* 124.0.0.0 - 124.255.255.255 (124.0.0.0/8)
* 125.0.0.0 - 125.255.255.255 (125.0.0.0/8)
* 126.0.0.0 - 126.255.255.255 (126.0.0.0/8)
* 127.0.0.0 - 127.255.255.255 (127.0.0.0/8)
* 128.0.0.0 - 128.255.255.255 (128.0.0.0/8)
* 129.0.0.0 - 129.255.255.255 (129.0.0.0/8)
* 130.0.0.0 - 130.255.255.255 (130.0.0.0/8)
* 131.0.0.0 - 131.255.255.255 (131.0.0.0/8)
* 132.0.0.0 - 132.255.255.255 (132.0.0.0/8)
* 133.0.0.0 - 133.255.255.255 (133.0.0.0/8)
* 134.0.0.0 - 134.255.255.255 (134.0.0.0/8)
* 135.0.0.0 - 135.255.255.255 (135.0.0.0/8)
* 136.0.0.0 - 136.255.255.255 (136.0.0.0/8)
* 137.0.0.0 - 137.255.255.255 (137.0.0.0/8)
* 138.0.0.0 - 138.255.255.255 (138.0.0.0/8)
* 139.0.0.0 - 139.255.255.255 (139.0.0.0/8)
* 140.0.0.0 - 140.255.255.255 (140.0.0.0/8)
* 141.0.0.0 - 141.255.255.255 (141.0.0.0/8)
* 142.0.0.0 - 142.255.255.255 (142.0.0.0/8)
* 143.0.0.0 - 143.255.255.255 (143.0.0.0/8)
* 144.0.0.0 - 144.255.255.255 (144.0.0.0/8)
* 145.0.0.0 - 145.255.255.255 (145.0.0.0/8)
* 146.0.0.0 - 146.255.255.255 (146.0.0.0/8)
* 147.0.0.0 - 147.255.255.255 (147.0.0.0/8)
* 148.0.0.0 - 148.255.255.255 (148.0.0.0/8)
* 149.0.0.0 - 149.255.255.255 (149.0.0.0/8)
* 150.0.0.0 - 150.255.255.255 (150.0.0.0/8)
* 151.0.0.0 - 151.255.255.255 (151.0.0.0/8)
* 152.0.0.0 - 152.255.255.255 (152.0.0.0/8)
* 153.0.0.0 - 153.255.255.255 (153.0.0.0/8)
* 154.0.0.0 - 154.255.255.255 (154.0.0.0/8)
* 155.0.0.0 - 155.255.255.255 (155.0.0.0/8)
* 156.0.0.0 - 156.255.255.255 (156.0.0.0/8)
* 157.0.0.0 - 157.255.255.255 (157.0.0.0/8)
* 158.0.0.0 - 158.255.255.255 (158.0.0.0/8)
* 159.0.0.0 - 159.255.255.255 (159.0.0.0/8)
* 160.0.0.0 - 160.255.255.255 (160.0.0.0/8)
* 161.0.0.0 - 161.255.255.255 (161.0.0.0/8)
* 162.0.0.0 - 162.255.255.255 (162.0.0.0/8)
* 163.0.0.0 - 163.255.255.255 (163.0.0.0/8)
* 164.0.0.0 - 164.255.255.255 (164.0.0.0/8)
* 165.0.0.0 - 165.255.255.255 (165.0.0.0/8)
* 166.0.0.0 - 166.255.255.255 (166.0.0.0/8)
* 167.0.0.0 - 167.255.255.255 (167.0.0.0/8)
* 168.0.0.0 - 168.255.255.255 (168.0.0.0/8)
* 169.0.0.0 - 169.255.255.255 (169.0.0.0/8)
* 170.0.0.0 - 170.255.255.255 (170.0.0.0/8)
* 171.0.0.0 - 171.255.255.255 (171.0.0.0/8)
* 172.0.0.0 - 172.255.255.255 (172.0.0.0/8)
* 173.0.0.0 - 173.255.255.255 (173.0.0.0/8)
* 174.0.0.0 - 174.255.255.255 (174.0.0.0/8)
* 175.0.0.0 - 175.255.255.255 (175.0.0.0/8)
* 176.0.0.0 - 176.255.255.255 (176.0.0.0/8)
* 177.0.0.0 - 177.255.255.255 (177.0.0.0/8)
* 178.0.0.0 - 178.255.255.255 (178.0.0.0/8)
* 179.0.0.0 - 179.255.255.255 (179.0.0.0/8)
* 180.0.0.0 - 180.255.255.255 (180.0.0.0/8)
* 181.0.0.0 - 181.255.255.255 (181.0.0.0/8)
* 182.0.0.0 - 182.255.255.255 (182.0.0.0/8)
* 183.0.0.0 - 183.255.255.255 (183.0.0.0/8)
* 184.0.0.0 - 184.255.255.255 (184.0.0.0/8)
* 185.0.0.0 - 185.255.255.255 (185.0.0.0/8)
* 186.0.0.0 - 186.255.255.255 (186.0.0.0/8)
* 187.0.0.0 - 187.255.255.255 (187.0.0.0/8)
* 188.0.0.0 - 188.255.255.255 (188.0.0.0/8)
* 189.0.0.0 - 189.255.255.255 (189.0.0.0/8)
* 190.0.0.0 - 190.255.255.255 (190.0.0.0/8)
* 191.0.0.0 - 191.255.255.255 (191.0.0.0/8)
* 192.0.0.0 - 192.255.255.255 (192.0.0.0/8)
* 193.0.0.0 - 193.255.255.255 (193.0.0.0/8)
* 194.0.0.0 - 194.255.255.255 (194.0.0.0/8)
* 195.0.0.0 - 195.255.255.255 (195.0.0.0/8)
* 196.0.0.0 - 196.255.255.255 (196.0.0.0/8)
* 197.0.0.0 - 197.255.255.255 (197.0.0.0/8)
* 198.0.0.0 - 198.255.255.255 (198.0.0.0/8)
* 199.0.0.0 - 199.255.255.255 (199.0.0.0/8)
* 200.0.0.0 - 200.255.255.255 (200.0.0.0/8)
* 201.0.0.0 - 201.255.255.255 (201.0.0.0/8)
* 202.0.0.0 - 202.255.255.255 (202.0.0.0/8)
* 203.0.0.0 - 203.255.255.255 (203.0.0.0/8)
* 204.0.0.0 - 204.255.255.255 (204.0.0.0/8)
* 205.0.0.0 - 205.255.255.255 (205.0.0.0/8)
* 206.0.0.0 - 206.255.255.255 (206.0.0.0/8)
* 207.0.0.0 - 207.255.255.255 (207.0.0.0/8)
* 208.0.0.0 - 208.255.255.255 (208.0.0.0/8)
* 209.0.0.0 - 209.255.255.255 (209.0.0.0/8)
* 210.0.0.0 - 210.255.255.255 (210.0.0.0/8)
* 211.0.0.0 - 211.255.255.255 (211.0.0.0/8)
* 212.0.0.0 - 212.255.255.255 (212.0.0.0/8)
* 213.0.0.0 - 213.255.255.255 (213.0.0.0/8)
* 214.0.0.0 - 214.255.255.255 (214.0.0.0/8)
* 215.0.0.0 - 215.255.255.255 (215.0.0.0/8)
* 216.0.0.0 - 216.255.255.255 (216.0.0.0/8)
* 217.0.0.0 - 217.255.255.255 (217.0.0.0/8)
* 218.0.0.0 - 218.255.255.255 (218.0.0.0/8)
* 219.0.0.0 - 219.255.255.255 (219.0.0.0/8)
* 220.0.0.0 - 220.255.255.255 (220.0.0.0/8)
* 221.0.0.0 - 221.255.255.255 (221.0.0.0/8)
* 222.0.0.0 - 222.255.255.255 (222.0.0.0/8)
* 223.0.0.0 - 223.255.255.255 (223.0.0.0/8)
* 224.0.0.0 - 224.255.255.255 (224.0.0.0/8)
* 225.0.0.0 - 225.255.255.255 (225.0.0.0/8)
* 226.0.0.0 - 226.255.255.255 (226.0.0.0/8)
* 227.0.0.0 - 227.255.255.255 (227.0.0.0/8)
* 228.0.0.0 - 228.255.255.255 (228.0.0.0/8)
* 229.0.0.0 - 229.255.255.255 (229.0.0.0/8)
* 230.0.0.0 - 230.255.255.255 (230.0.0.0/8)
* 231.0.0.0 - 231.255.255.255 (231.0.0.0/8)
* 232.0.0.0 - 232.255.255.255 (232.0.0.0/8)
* 233.0.0.0 - 233.255.255.255 (233.0.0.0/8)
* 234.0.0.0 - 234.255.255.255 (234.0.0.0/8)
* 235.0.0.0 - 235.255.255.255 (235.0.0.0/8)
* 236.0.0.0 - 236.255.255.255 (236.0.0.0/8)
* 237.0.0.0 - 237.255.255.255 (237.0.0.0/8)
* 238.0.0.0 - 238.255.255.255 (238.0.0.0/8)
* 239.0.0.0 - 239.255.255.255 (239.0.0.0/8)
* 240.0.0.0 - 240.255.255.255 (240.0.0.0/8)
* 241.0.0.0 - 241.255.255.255 (241.0.0.0/8)
* 242.0.0.0 - 242.255.255.255 (242.0.0.0/8)
* 243.0.0.0 - 243.255.255.255 (243.0.0.0/8)
* 244.0.0.0 - 244.255.255.255 (244.0.0.0/8)
* 245.0.0.0 - 245.255.255.255 (245.0.0.0/8)
* 246.0.0.0 - 246.255.255.255 (246.0.0.0/8)
* 247.0.0.0 - 247.255.255.255 (247.0.0.0/8)
* 248.0.0.0 - 248.255.255.255 (248.0.0.0/8)
* 249.0.0.0 - 249.255.255.255 (249.0.0.0/8)
* 250.0.0.0 - 250.255.255.255 (250.0.0.0/8)
* 251.0.0.0 - 251.255.255.255 (251.0.0.0/8)
* 252.0.0.0 - 252.255.255.255 (252.0.0.0/8)
* 253.0.0.0 - 253.255.255.255 (253.0.0.0/8)
* 254.0.0.0 - 254.255.255.255 (254.0.0.0/8)
* 255.0.0.0 - 255.255.255.255 (255.0.0.0/8)