Get hostname and Geo location
info for any IP



Whois Lookup
Get contact info for a domain/ip
Traceroute
Shows network route to host
Your iP is: 34.231.247.88 United States Near: Ashburn, Virginia, United States

This is where you are:

IP Information - 34.231.247.88

Host name: ec2-34-231-247-88.compute-1.amazonaws.com

Country: United States

Country Code: US

Region: VA

City: Ashburn

Latitude: 39.0481

Longitude: -77.4728

LEMOINE is reporting 209.85.210.53

RECEIPT again these same emails stolen French LA POSTE using mails boxes and IP Address of GOOGLE FRANÇAIS : RECEPTION mêmes emails d'escroqueries usurpant ENCORE LA POSTE en France avec adresse email bidon en GMAIL Bonjour Webmasters de LAPOSTE.net, et SIGNAL SPAM, et alertespam@labanquepostale.fr et abuse@ripe.net et hostmaster@ripe.net et abuse@google.com et abuse@gmail.com et network-abuse@google.com et arin-contact@google.com and F.B.I. Services in U.S.A ( for Google ) in hidden copy for Adress IP in U.S.A ( https://complaint.ic3.gov/default.aspx ) Et celà continue toujours fin Mai 2022 et ceci depuis au moins +17 années ( emails tous archivés complets avec tous leurs codes HTML depuis 2007 )( il y a forcément des complicités, du laxisme, des incompétents d’Etats et Services Administratifs chez des fournisseurs d’accès, depuis toutes ces +16 années que celà dure ! Ces escrocs ont vraiment la belle vie pour sévir en France ! Ce Samedi 21 Mai 2022 après 10h38 du matin ( très souvent les week-ends, ou très souvent les nuits, avant ou après les horaires des Bureaux et Administrations en France, méthodes de faux-culs et d’escrocs ) j'ai encore reçu sur ma boite email ce même email d’escroqueries avec faux contenu de LAPOSTE et venant de l'adresse email bidon ou usurpée,volée : bajoumanamanga@gmail.com Les adresses IP utilisées par le PC de ce(s) batards de hackers fous, débiles, têtus, butés, et analphabètes ( incapables d’écrire correctement le Français ) et ces mails sont préparés, envoyés en différés qqs heures ( 01h38 cette nuit ) ou 1 jour avant, pour ne pas être tracés par un logiciel Sniffer sur leurs adresses Mac de cartes réseaux, ou par des commandes Traceroute sur leurs adresses IP en direct ( bandes de poules mouillées, fumiers, trouillards ! ): 209.85.210.53 aux U.S.A ! Received : from mail-ot1-f53.google.com (mail-ot1-f53.google.com [209.85.210.53]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by mlpnf0105.laposte.net (SMTP Server) with ESMTPS id 4L4xp61m4pznTTx for <@laposte.net>; Sat, 21 May 2022 10:38:54 +0200 (CEST) Received : by mail-ot1-f53.google.com with SMTP id l9-20020a056830268900b006054381dd35so6937893otu.4 for <@laposte.net>; Sat, 21 May 2022 01:38:54 -0700 (PDT) ………………… From : "User+" <bajoumanamanga@gmail.com> Date : Sat, 21 May 2022 02:06:09 +0200 IP Lookup Details: IP Information - 209.85.210.53 Host name: mail-ot1-f53.google.com Country: United States Country Code: US Region: City: Latitude: 37.751 Longitude: -97.822 utilisant encore des boites emails de GOOGLE et les serveurs IP de chez GOOGLE. C'est visiblement et clairement une tentative de phishing et fraude ( fautes de grammaire multiples ) Ci-dessous cet email d’escroquerie avec ces en-têtes complets : ***************** CONTENU du mail d’escroquerie ******************* Mise à jour • Aujourd'hui, à 10:38 (il y a une heure) 29Ko • • • De : User+ • A : undisclosed-recipients:; Cher (e) Abonné(e) Nous vous avons récemment informé des mises à jour concernant la manière dont nous traitons vos données, conformément à la réglementation de l’Union Européenne sur la protection des données personnelles L'Équipe Laposte Mail ************** Codes HTML complets ci-dessous *********************** Return-Path : <bajoumanamanga@gmail.com> Received : from mlpnf0105.laposte.net (mlpnf0105.sys.meshcore.net [10.94.128.84]) by mlpnb0108 with LMTPA; Sat, 21 May 2022 10:38:54 +0200 X-Cyrus-Session-Id : cyrus-101408-1653122334-2-16731276272001803988 X-Sieve : CMU Sieve 3.0 X-mail-filterd : {"version":"1.4.3","queueID":"4L4xp64NGpznTTy","contextId":"83f42925-1abe-48a4-9bc7-366f5f72ca7f"} X-ppbforward : {"queueID":"4L4xp64NGpznTTy","server":"mlpnf0105"} Received : from outgoing-mail.laposte.net (localhost.localdomain [127.0.0.1]) by mlpnf0105.laposte.net (SMTP Server) with ESMTP id 4L4xp64NGpznTTy for <lpn000000000000000018870443@back01-mail02-04.lpn.svc.meshcore.net>; Sat, 21 May 2022 10:38:54 +0200 (CEST) X-mail-filterd : {"version":"1.4.3","queueID":"4L4xp61m4pznTTx","contextId":"652e04ba-46f4-410a-86ec-3ba26efe4905"} X-lpn-mailing : LEGIT X-lpn-spamrating : 48 X-lpn-spamlevel : not-spam Authentication-Results : laposte.net; spf=pass smtp.mailfrom=bajoumanamanga@gmail.com smtp.helo=mail-ot1-f53.google.com; dkim=pass reason="good signature" header.d=gmail.com header.s=20210112 header.b=HKDuHM; dmarc=pass reason="SPF is aligned, DKIM is aligned"; bimi=skipped reason="non-compliant DMARC" X-lpn-spamcause : OK, (40)(0000)gggruggvucftvghtrhhoucdtuddrgedvfedrieehgddufedtucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecunfetrffquffvgfdpggftfghnshhusghstghrihgsvgenuceurghilhhouhhtmecufedtudenucgouhhnughishgtlhhoshgvugculdegtddmnecujfgurhepggfhfffkufgtsehmtderredttdejnecuhfhrohhmpedffghsvghroddfuceosggrjhhouhhmrghnrghmrghnghgrsehgmhgrihhlrdgtohhmqeenucggtffrrghtthgvrhhnpedvleffhfduveekhfegtdevudehhfduhfeijeehgfekgfeiudeileevffdtvddvieenucfkphepvddtledrkeehrddvuddtrdehfeenucevlhhushhtvghrufhiiigvpedunecurfgrrhgrmhepihhnvghtpedvtdelrdekhedrvddutddrheefpdhhvghlohepmhgrihhlqdhothduqdhfheefrdhgohhoghhlvgdrtghomhdpmhgrihhlfhhrohhmpegsrghjohhumhgrnhgrmhgrnhhgrgesghhmrghilhdrtghomhdpnhgspghrtghpthhtohepuddprhgtphhtthhopegvlhgvrdhlvghmohhinhgvsehlrghpohhsthgvrdhnvghtpdhsphhfpehprghsshdpughkihhmpehprghsshdpughmrghrtgepphgrshhs Received : from mail-ot1-f53.google.com (mail-ot1-f53.google.com [209.85.210.53]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by mlpnf0105.laposte.net (SMTP Server) with ESMTPS id 4L4xp61m4pznTTx for <ele.lemoine@laposte.net>; Sat, 21 May 2022 10:38:54 +0200 (CEST) Received : by mail-ot1-f53.google.com with SMTP id l9-20020a056830268900b006054381dd35so6937893otu.4 for <ele.lemoine@laposte.net>; Sat, 21 May 2022 01:38:54 -0700 (PDT) DKIM-Signature : v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20210112; h=mime-version:from:date:message-id:subject:to; bh=HhIkDftJLrYIXEjR5Ub514bLi/pTAn/wHcUT3WsGCjk=; b=HKDuHMmroFyotDx6CLNq9p7FYssKlw7QxEvlqHtsdOrFJtA0OqOUqRFLB10mjQ0d8T THPMEf6yzp5cMDTKE2Jzx7HBWEOt/rdtbetDRs2xC6Q/M5HUooW6eb0JVD+EDH/twDv2 qy7/UWCP8CM6NBhThkOZ6KQIxkNYFtf4MgMYADYSBBRSLw7QnxI7sjp0iQZCJ+eseQt+ HY2wxydc3kCejF1hINushVZTaAxS7OytbClfEIJhDQaAvRIu61mPv4+CD7loJfFCpfCR 7aE0IqCdTo+mfho4sUrJPNKMG1EVfdYlAyAnoUVSykG5XakO5j9nH3hp2rwkgMHC16h7 Okkw== X-Google-DKIM-Signature : v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20210112; h=x-gm-message-state:mime-version:from:date:message-id:subject:to; bh=HhIkDftJLrYIXEjR5Ub514bLi/pTAn/wHcUT3WsGCjk=; b=fqYyeSd0RUBwuFWC10V6PmcKX5wIhu4KMMbdlrjGBKQVbsb6NlEoYMo1u1ZgoXcstG QWqzvAvWNhgR7ED/EG1502EUXf3XapzcTvVI1+LnMVDHRFnN9MWB7GCXpypJSqP8XIWy YxP/gLtCcuFnNFTY99t//vEOrqsbN5xTSXfVWPXtCdrIqAzpBrCatFU/qdtKweMEjy44 k2Qav3FYaRVAJJYcOj/Q6l/WgXdJUuXU5dPzISGW/mJl7N5JAY1A3ogwUWxTdr6rG6UG kac4HoYSiw4ypbLaf5CF0GzfPpxyPEsvUp9u/6OQ/F8JDNdjOpzXT68HBWr5H9uPil9d Lcbg== X-Gm-Message-State : AOAM533oqF3wJxdoPImkQLF26DLEvEVlcLmMNI4lT/AHCrTD9Bl9Hl+j man3TBw5vwHG0KhmFpELSsy2rrOjd6sdsPWy95HGLIRIEnKAYA== X-Google-Smtp-Source : ABdhPJyMYD44nXxrDeIp2fFVktgOJQsrXNlsC7JRPncG8PvDk9jATt+DB5NBc1rEPu3Nhm0PZ8ry5DnZkY3j6kYDctM= X-Received : by 2002:a81:ac1:0:b0:2ff:14f1:af3a with SMTP id 184-20020a810ac1000000b002ff14f1af3amr12498525ywk.247.1653091580435; Fri, 20 May 2022 17:06:20 -0700 (PDT) MIME-Version : 1.0 From : "User+" <bajoumanamanga@gmail.com> Date : Sat, 21 May 2022 02:06:09 +0200 Message-ID : <CAMTH+kGCYR71q-0eXBfkf-bXZv12y_rja7Y8e10QsuOpqSRH3w@mail.gmail.com> Subject : Mise à jour To : undisclosed-recipients:; Content-Type : multipart/mixed; boundary="0000000000006f174e05df7a6039"

IP identified as: Hackers IP, Reported on: 21st, May. 2022
Shex1234556 is reporting 130.193.255.138

http://130.193.245.170/

IP identified as: This is my IP, Reported on: 20th, May. 2022
Shex1234556 is reporting 130.193.255.138

http://130.193.245.170/

IP identified as: This is my IP, Reported on: 20th, May. 2022
Shex1234556 is reporting 130.193.255.138

http://130.193.245.170/

IP identified as: This is my IP, Reported on: 20th, May. 2022
. is reporting 93.51.114.54

https://www.facebook.com/profile.php?id=100079925394164&sk=photos This person got into my account and tried to hack me: IP: 93.51.114.54 Nombre de host: 93-51-114-54.ip349.fastwebnet.it Windows, Chrome Phone Number: +7 926 731-81-87 Location: Cassano Delle Murge, PUGLIA, IT

IP identified as: Hackers IP, Reported on: 20th, May. 2022
Ibrahim is reporting 179.43.187.87

This IP resolves from the domain "ptsb-review.com" and serves a replica of online banking website for PTSP ireland. I got this in a SMS that say there was unusual activity on your card and it has been blocked. I know it is spam as I don't have a bank account with PTSB.

IP identified as: Hackers IP, Reported on: 20th, May. 2022
Biraj is reporting 141.0.8.55

103.28.84.162

IP identified as: Mobile device IP, Reported on: 19th, May. 2022
スーパーコピー時計 is reporting 35.203.149.23

人気の売れ筋商品を多数取り揃えております 全て激安特価でご提供.お願いします. ★100%品質保証!満足保障!リピーター率100%! ★商品数も大幅に増え、品質も大自信です。 ★スタイルが多い、品質がよい、価格が低い! ★顧客は至上 誠実 信用。 ★歓迎光臨 https://guanlutokei.top https://xingto22.exblog.jp/ https://www.himawarinet.com/blog/watchod/

Reported on: 18th, May. 2022
Angel Rubio Martinez is reporting 201.110.84.193

Good website

Reported on: 18th, May. 2022
CatherinaShaw is reporting 50.19.113.85

Неllо all, guуsǃ I know, mу meѕѕаgе mау bе tоо speсifіс, Βut my siѕter found niсe mаn herе and thеу marrіеd, sо how abоut mе?ǃ :) Ι am 24 yеarѕ оld, Саtherіna, from Rоmаnіа, I knоw Εnglіѕh аnd Gеrman lаnguagеs аlѕo Αnd... I hаvе sресifіс disеase, namеd nуmрhomаnіa. Ԝhо knоw what iѕ this, саn undеrstаnd mе (bеtter to ѕаy it іmmеdiаtelу) Αh yеs, Ι соok vеrу tаѕtу! and Ι love nоt only cook ;)) Im rеal gіrl, nоt prоstіtutе, аnd lookіng fоr ѕerіous and hоt rеlationshір... Αnywaу, уоu can find my profіle here: http://attofermune.tk/user/42450/

Reported on: 18th, May. 2022
Charles Montgomery is reporting 73.32.52.221

73.32.52.221 Who has been using my account?

IP identified as: Residentail IP, Reported on: 18th, May. 2022
Guja is reporting 195.113.48.9

Report block and lay criminal charges asap used to hack

IP identified as: School/University IP, Reported on: 18th, May. 2022
younes mohamed is reporting 142.250.81.193

hey how are you

IP identified as: This is my IP, Reported on: 18th, May. 2022
younes is reporting 160.176.226.202

mjkj

Reported on: 18th, May. 2022
Anonymous is reporting 65

93

IP identified as: Website IP, Reported on: 18th, May. 2022
JamesPyday is reporting /lookup_whois.php

Центр биржевых технологий 136 • 15 декабря 2016 • Одесса • Доверительный Если вы хотите,чтобы вас обокрали.Не заплатили вам зарплату.Заставили открыть на себя частного предпринимателя и платить со своего кармана налоги в налоговую.Вам прямая дорога в ЦБТ. Штрафы по любому поводу.При чем штрафы от 50 уе и выше.Это при зарплате 300уе.Хамство руководства.Постоянные переработки.Самое главное - люди эти не честные!ЕСЛИ ВЫ НЕ ВРАГ СЕБЕ И СВОЕМУ ЗДОРОВЬЮ,ОБХОДИТЕ ИХ МИМО! 0 Нам очень важна ваша поддержка Стать патроном Отправить крипту Отправить деньги Мерч Antijob 8 Комментариев Создайте или войдите в аккаунт, чтобы комментрировать Анна 20 марта 2021 12:37:15 Даже уголовные дела, которые ведутся против создателя ЦБТ Телетрейд, не могут заставить одуматься сотрудников Показать полностью Ответить 0 Руслан 19 марта 2021 18:05:47 Беспринципность ЦБТ просто поражает. Мало того, что Центр Биржевых Технологий свою обучающую программу ухудшает каждый год, в чем я и мои друзья уже убедились на собственном опыте, так он по-прежнему Показать полностью Ответить 0 Владимир 18 марта 2021 10:57:37 Я видел разные отзывы про Центр Биржевых Технологий, и разные ответы представителей этой компании на те отзывы, но то, что в последнее время сочиняет эта компания, на голову не налазет! Это ЦТБ являет Показать полностью Ответить 0 Василий 7 декабря 2017 05:58:44 Прикольно, что у нас есть такие компании, которые обучают торговать. Я ходил в центр биржевых технологий на обучение в прошлом месяце. Все курсы длились две недели. За это время нам рассказали о том, Показать полностью Ответить 0 Алекс 26 марта 2019 14:09:56 Левый коммент в стиле ЦБТ. Они любят себе везде писать хорошие комменты на ютюбе. Только вот просчитались немного с городом, ляпнули киевский коммент в Одессу. Или я живу в Одессе на другой планете, г Показать полностью Ответить 0 Станислав 20 ноября 2017 02:32:59 В прошлом году я устроился на работу в центре биржевых технологий в Одессе, офис у них на вице адмирала Жукова, 14, недалеко от греческой площади. Офис конечно красивый они себе сделали, видно, что но Показать полностью Ответить 0 hone 7 марта 2017 17:59:44 Доброго всем дня!я работал в так называемой компании центр биржевых технологий а по старому они назывались телетрейд и я вам скажу что это просто шарашкина кантора,которая за счет своих клиентов построила себе 5-ти этажный бизнес центр WS ))) вы только посмотрите какое громкое название WS(Wall Street) и еще рядом 3-х этажную гостиницу.Такие шарлатаны как они должны сидеть в тюрьме. В этой компании работают как они любят себя называть профессионалы с большой буквы а на самом деле просто полнейшие дилетанты,там безусловно есть талантливые ребята которые работают и еще не разобрались в какой гадючник они попали но когда они поймут то сразу уходят от них .Они заманивают к себе большой зарплатой но по факту они находят кучу причин оштрафовать вас на 50 или 100 $ при ЗП 300 и при этом еще говорят скажи спасибо что не 150$ Я имел счастье общаться с многими начальниками но там есть такие уникумы что просто нет слов.Самый большой начальник в "" это Эльвира Александровна большая шишка которая практически все рабочее время проводила в салоне красоты на маникюре или выщупывала себе брови или Леонид начальник компьютерного отдела который думает что он самый умный и ходит по центру как напыщенный индюк и полирует свою лысину до блеска .Я надеюсь что наша милиция в скором будущем возьмется за вас и вы получите за все так сказать хорошее что вы сделали... Скрыть Ответить 0 ghost 29 апреля 2017 03:44:38 всем доброго дня! хочу вас предупредить что бы вы не шли работать в телетреид особенно на 4 этаж там работает упырь по имени лёня да да именно с маленькой буквы "л",он думает что он самый умный а

Reported on: 17th, May. 2022
Kate Hewko is reporting 96.55.217.10

Head's up, we had a fraudulent order traced to this IP!

Reported on: 17th, May. 2022
Jetsuveli is reporting 5588293671

Ingormacion

IP identified as: Mobile device IP, Reported on: 17th, May. 2022
LindaG. is reporting 142.116.83.96

142.116.83.96 - Address tracked to a account that has hacked a Facebook page.

IP identified as: Spammers IP, Reported on: 16th, May. 2022
TysonOxifs is reporting /lookup_whois.php

unethost無限空間虛擬主機 技術分享部落格 http://blog.unethost.com/

Reported on: 15th, May. 2022
Howardurges is reporting /lookup_whois.php

太達數位媒體 https://deltamarketing.com.tw/

Reported on: 15th, May. 2022
JamesDum is reporting /lookup_whois.php

太達數位媒體 https://deltamarketing.com.tw/

Reported on: 14th, May. 2022
Stefannel is reporting 104.47.17.175

Originator of spam

Reported on: 14th, May. 2022
What a Fool! is reporting 41.44.102.136

So is IP grabbing illegal? Nope. There's no specific law preventing someone from targeting you with an IP grabbing tool. Your IP address is pretty much public information at this point – just like your street address or phone number.

Reported on: 14th, May. 2022
Hey Stop Using My Wifi. is reporting 103.174.85.158

Hehe get your Own Wifi Hakku.

Reported on: 14th, May. 2022
 1 2 3 4 5 6 7 8 9 10 11 Next 
List of Class A IP ranges (click to view)
* 1.0.0.0 - 1.255.255.255 (1.0.0.0/8)
* 2.0.0.0 - 2.255.255.255 (2.0.0.0/8)
* 3.0.0.0 - 3.255.255.255 (3.0.0.0/8)
* 4.0.0.0 - 4.255.255.255 (4.0.0.0/8)
* 5.0.0.0 - 5.255.255.255 (5.0.0.0/8)
* 6.0.0.0 - 6.255.255.255 (6.0.0.0/8)
* 7.0.0.0 - 7.255.255.255 (7.0.0.0/8)
* 8.0.0.0 - 8.255.255.255 (8.0.0.0/8)
* 9.0.0.0 - 9.255.255.255 (9.0.0.0/8)
* 10.0.0.0 - 10.255.255.255 (10.0.0.0/8)
* 11.0.0.0 - 11.255.255.255 (11.0.0.0/8)
* 12.0.0.0 - 12.255.255.255 (12.0.0.0/8)
* 13.0.0.0 - 13.255.255.255 (13.0.0.0/8)
* 14.0.0.0 - 14.255.255.255 (14.0.0.0/8)
* 15.0.0.0 - 15.255.255.255 (15.0.0.0/8)
* 16.0.0.0 - 16.255.255.255 (16.0.0.0/8)
* 17.0.0.0 - 17.255.255.255 (17.0.0.0/8)
* 18.0.0.0 - 18.255.255.255 (18.0.0.0/8)
* 19.0.0.0 - 19.255.255.255 (19.0.0.0/8)
* 20.0.0.0 - 20.255.255.255 (20.0.0.0/8)
* 21.0.0.0 - 21.255.255.255 (21.0.0.0/8)
* 22.0.0.0 - 22.255.255.255 (22.0.0.0/8)
* 23.0.0.0 - 23.255.255.255 (23.0.0.0/8)
* 24.0.0.0 - 24.255.255.255 (24.0.0.0/8)
* 25.0.0.0 - 25.255.255.255 (25.0.0.0/8)
* 26.0.0.0 - 26.255.255.255 (26.0.0.0/8)
* 27.0.0.0 - 27.255.255.255 (27.0.0.0/8)
* 28.0.0.0 - 28.255.255.255 (28.0.0.0/8)
* 29.0.0.0 - 29.255.255.255 (29.0.0.0/8)
* 30.0.0.0 - 30.255.255.255 (30.0.0.0/8)
* 31.0.0.0 - 31.255.255.255 (31.0.0.0/8)
* 32.0.0.0 - 32.255.255.255 (32.0.0.0/8)
* 33.0.0.0 - 33.255.255.255 (33.0.0.0/8)
* 34.0.0.0 - 34.255.255.255 (34.0.0.0/8)
* 35.0.0.0 - 35.255.255.255 (35.0.0.0/8)
* 36.0.0.0 - 36.255.255.255 (36.0.0.0/8)
* 37.0.0.0 - 37.255.255.255 (37.0.0.0/8)
* 38.0.0.0 - 38.255.255.255 (38.0.0.0/8)
* 39.0.0.0 - 39.255.255.255 (39.0.0.0/8)
* 40.0.0.0 - 40.255.255.255 (40.0.0.0/8)
* 41.0.0.0 - 41.255.255.255 (41.0.0.0/8)
* 42.0.0.0 - 42.255.255.255 (42.0.0.0/8)
* 43.0.0.0 - 43.255.255.255 (43.0.0.0/8)
* 44.0.0.0 - 44.255.255.255 (44.0.0.0/8)
* 45.0.0.0 - 45.255.255.255 (45.0.0.0/8)
* 46.0.0.0 - 46.255.255.255 (46.0.0.0/8)
* 47.0.0.0 - 47.255.255.255 (47.0.0.0/8)
* 48.0.0.0 - 48.255.255.255 (48.0.0.0/8)
* 49.0.0.0 - 49.255.255.255 (49.0.0.0/8)
* 50.0.0.0 - 50.255.255.255 (50.0.0.0/8)
* 51.0.0.0 - 51.255.255.255 (51.0.0.0/8)
* 52.0.0.0 - 52.255.255.255 (52.0.0.0/8)
* 53.0.0.0 - 53.255.255.255 (53.0.0.0/8)
* 54.0.0.0 - 54.255.255.255 (54.0.0.0/8)
* 55.0.0.0 - 55.255.255.255 (55.0.0.0/8)
* 56.0.0.0 - 56.255.255.255 (56.0.0.0/8)
* 57.0.0.0 - 57.255.255.255 (57.0.0.0/8)
* 58.0.0.0 - 58.255.255.255 (58.0.0.0/8)
* 59.0.0.0 - 59.255.255.255 (59.0.0.0/8)
* 60.0.0.0 - 60.255.255.255 (60.0.0.0/8)
* 61.0.0.0 - 61.255.255.255 (61.0.0.0/8)
* 62.0.0.0 - 62.255.255.255 (62.0.0.0/8)
* 63.0.0.0 - 63.255.255.255 (63.0.0.0/8)
* 64.0.0.0 - 64.255.255.255 (64.0.0.0/8)
* 65.0.0.0 - 65.255.255.255 (65.0.0.0/8)
* 66.0.0.0 - 66.255.255.255 (66.0.0.0/8)
* 67.0.0.0 - 67.255.255.255 (67.0.0.0/8)
* 68.0.0.0 - 68.255.255.255 (68.0.0.0/8)
* 69.0.0.0 - 69.255.255.255 (69.0.0.0/8)
* 70.0.0.0 - 70.255.255.255 (70.0.0.0/8)
* 71.0.0.0 - 71.255.255.255 (71.0.0.0/8)
* 72.0.0.0 - 72.255.255.255 (72.0.0.0/8)
* 73.0.0.0 - 73.255.255.255 (73.0.0.0/8)
* 74.0.0.0 - 74.255.255.255 (74.0.0.0/8)
* 75.0.0.0 - 75.255.255.255 (75.0.0.0/8)
* 76.0.0.0 - 76.255.255.255 (76.0.0.0/8)
* 77.0.0.0 - 77.255.255.255 (77.0.0.0/8)
* 78.0.0.0 - 78.255.255.255 (78.0.0.0/8)
* 79.0.0.0 - 79.255.255.255 (79.0.0.0/8)
* 80.0.0.0 - 80.255.255.255 (80.0.0.0/8)
* 81.0.0.0 - 81.255.255.255 (81.0.0.0/8)
* 82.0.0.0 - 82.255.255.255 (82.0.0.0/8)
* 83.0.0.0 - 83.255.255.255 (83.0.0.0/8)
* 84.0.0.0 - 84.255.255.255 (84.0.0.0/8)
* 85.0.0.0 - 85.255.255.255 (85.0.0.0/8)
* 86.0.0.0 - 86.255.255.255 (86.0.0.0/8)
* 87.0.0.0 - 87.255.255.255 (87.0.0.0/8)
* 88.0.0.0 - 88.255.255.255 (88.0.0.0/8)
* 89.0.0.0 - 89.255.255.255 (89.0.0.0/8)
* 90.0.0.0 - 90.255.255.255 (90.0.0.0/8)
* 91.0.0.0 - 91.255.255.255 (91.0.0.0/8)
* 92.0.0.0 - 92.255.255.255 (92.0.0.0/8)
* 93.0.0.0 - 93.255.255.255 (93.0.0.0/8)
* 94.0.0.0 - 94.255.255.255 (94.0.0.0/8)
* 95.0.0.0 - 95.255.255.255 (95.0.0.0/8)
* 96.0.0.0 - 96.255.255.255 (96.0.0.0/8)
* 97.0.0.0 - 97.255.255.255 (97.0.0.0/8)
* 98.0.0.0 - 98.255.255.255 (98.0.0.0/8)
* 99.0.0.0 - 99.255.255.255 (99.0.0.0/8)
* 100.0.0.0 - 100.255.255.255 (100.0.0.0/8)
* 101.0.0.0 - 101.255.255.255 (101.0.0.0/8)
* 102.0.0.0 - 102.255.255.255 (102.0.0.0/8)
* 103.0.0.0 - 103.255.255.255 (103.0.0.0/8)
* 104.0.0.0 - 104.255.255.255 (104.0.0.0/8)
* 105.0.0.0 - 105.255.255.255 (105.0.0.0/8)
* 106.0.0.0 - 106.255.255.255 (106.0.0.0/8)
* 107.0.0.0 - 107.255.255.255 (107.0.0.0/8)
* 108.0.0.0 - 108.255.255.255 (108.0.0.0/8)
* 109.0.0.0 - 109.255.255.255 (109.0.0.0/8)
* 110.0.0.0 - 110.255.255.255 (110.0.0.0/8)
* 111.0.0.0 - 111.255.255.255 (111.0.0.0/8)
* 112.0.0.0 - 112.255.255.255 (112.0.0.0/8)
* 113.0.0.0 - 113.255.255.255 (113.0.0.0/8)
* 114.0.0.0 - 114.255.255.255 (114.0.0.0/8)
* 115.0.0.0 - 115.255.255.255 (115.0.0.0/8)
* 116.0.0.0 - 116.255.255.255 (116.0.0.0/8)
* 117.0.0.0 - 117.255.255.255 (117.0.0.0/8)
* 118.0.0.0 - 118.255.255.255 (118.0.0.0/8)
* 119.0.0.0 - 119.255.255.255 (119.0.0.0/8)
* 120.0.0.0 - 120.255.255.255 (120.0.0.0/8)
* 121.0.0.0 - 121.255.255.255 (121.0.0.0/8)
* 122.0.0.0 - 122.255.255.255 (122.0.0.0/8)
* 123.0.0.0 - 123.255.255.255 (123.0.0.0/8)
* 124.0.0.0 - 124.255.255.255 (124.0.0.0/8)
* 125.0.0.0 - 125.255.255.255 (125.0.0.0/8)
* 126.0.0.0 - 126.255.255.255 (126.0.0.0/8)
* 127.0.0.0 - 127.255.255.255 (127.0.0.0/8)
* 128.0.0.0 - 128.255.255.255 (128.0.0.0/8)
* 129.0.0.0 - 129.255.255.255 (129.0.0.0/8)
* 130.0.0.0 - 130.255.255.255 (130.0.0.0/8)
* 131.0.0.0 - 131.255.255.255 (131.0.0.0/8)
* 132.0.0.0 - 132.255.255.255 (132.0.0.0/8)
* 133.0.0.0 - 133.255.255.255 (133.0.0.0/8)
* 134.0.0.0 - 134.255.255.255 (134.0.0.0/8)
* 135.0.0.0 - 135.255.255.255 (135.0.0.0/8)
* 136.0.0.0 - 136.255.255.255 (136.0.0.0/8)
* 137.0.0.0 - 137.255.255.255 (137.0.0.0/8)
* 138.0.0.0 - 138.255.255.255 (138.0.0.0/8)
* 139.0.0.0 - 139.255.255.255 (139.0.0.0/8)
* 140.0.0.0 - 140.255.255.255 (140.0.0.0/8)
* 141.0.0.0 - 141.255.255.255 (141.0.0.0/8)
* 142.0.0.0 - 142.255.255.255 (142.0.0.0/8)
* 143.0.0.0 - 143.255.255.255 (143.0.0.0/8)
* 144.0.0.0 - 144.255.255.255 (144.0.0.0/8)
* 145.0.0.0 - 145.255.255.255 (145.0.0.0/8)
* 146.0.0.0 - 146.255.255.255 (146.0.0.0/8)
* 147.0.0.0 - 147.255.255.255 (147.0.0.0/8)
* 148.0.0.0 - 148.255.255.255 (148.0.0.0/8)
* 149.0.0.0 - 149.255.255.255 (149.0.0.0/8)
* 150.0.0.0 - 150.255.255.255 (150.0.0.0/8)
* 151.0.0.0 - 151.255.255.255 (151.0.0.0/8)
* 152.0.0.0 - 152.255.255.255 (152.0.0.0/8)
* 153.0.0.0 - 153.255.255.255 (153.0.0.0/8)
* 154.0.0.0 - 154.255.255.255 (154.0.0.0/8)
* 155.0.0.0 - 155.255.255.255 (155.0.0.0/8)
* 156.0.0.0 - 156.255.255.255 (156.0.0.0/8)
* 157.0.0.0 - 157.255.255.255 (157.0.0.0/8)
* 158.0.0.0 - 158.255.255.255 (158.0.0.0/8)
* 159.0.0.0 - 159.255.255.255 (159.0.0.0/8)
* 160.0.0.0 - 160.255.255.255 (160.0.0.0/8)
* 161.0.0.0 - 161.255.255.255 (161.0.0.0/8)
* 162.0.0.0 - 162.255.255.255 (162.0.0.0/8)
* 163.0.0.0 - 163.255.255.255 (163.0.0.0/8)
* 164.0.0.0 - 164.255.255.255 (164.0.0.0/8)
* 165.0.0.0 - 165.255.255.255 (165.0.0.0/8)
* 166.0.0.0 - 166.255.255.255 (166.0.0.0/8)
* 167.0.0.0 - 167.255.255.255 (167.0.0.0/8)
* 168.0.0.0 - 168.255.255.255 (168.0.0.0/8)
* 169.0.0.0 - 169.255.255.255 (169.0.0.0/8)
* 170.0.0.0 - 170.255.255.255 (170.0.0.0/8)
* 171.0.0.0 - 171.255.255.255 (171.0.0.0/8)
* 172.0.0.0 - 172.255.255.255 (172.0.0.0/8)
* 173.0.0.0 - 173.255.255.255 (173.0.0.0/8)
* 174.0.0.0 - 174.255.255.255 (174.0.0.0/8)
* 175.0.0.0 - 175.255.255.255 (175.0.0.0/8)
* 176.0.0.0 - 176.255.255.255 (176.0.0.0/8)
* 177.0.0.0 - 177.255.255.255 (177.0.0.0/8)
* 178.0.0.0 - 178.255.255.255 (178.0.0.0/8)
* 179.0.0.0 - 179.255.255.255 (179.0.0.0/8)
* 180.0.0.0 - 180.255.255.255 (180.0.0.0/8)
* 181.0.0.0 - 181.255.255.255 (181.0.0.0/8)
* 182.0.0.0 - 182.255.255.255 (182.0.0.0/8)
* 183.0.0.0 - 183.255.255.255 (183.0.0.0/8)
* 184.0.0.0 - 184.255.255.255 (184.0.0.0/8)
* 185.0.0.0 - 185.255.255.255 (185.0.0.0/8)
* 186.0.0.0 - 186.255.255.255 (186.0.0.0/8)
* 187.0.0.0 - 187.255.255.255 (187.0.0.0/8)
* 188.0.0.0 - 188.255.255.255 (188.0.0.0/8)
* 189.0.0.0 - 189.255.255.255 (189.0.0.0/8)
* 190.0.0.0 - 190.255.255.255 (190.0.0.0/8)
* 191.0.0.0 - 191.255.255.255 (191.0.0.0/8)
* 192.0.0.0 - 192.255.255.255 (192.0.0.0/8)
* 193.0.0.0 - 193.255.255.255 (193.0.0.0/8)
* 194.0.0.0 - 194.255.255.255 (194.0.0.0/8)
* 195.0.0.0 - 195.255.255.255 (195.0.0.0/8)
* 196.0.0.0 - 196.255.255.255 (196.0.0.0/8)
* 197.0.0.0 - 197.255.255.255 (197.0.0.0/8)
* 198.0.0.0 - 198.255.255.255 (198.0.0.0/8)
* 199.0.0.0 - 199.255.255.255 (199.0.0.0/8)
* 200.0.0.0 - 200.255.255.255 (200.0.0.0/8)
* 201.0.0.0 - 201.255.255.255 (201.0.0.0/8)
* 202.0.0.0 - 202.255.255.255 (202.0.0.0/8)
* 203.0.0.0 - 203.255.255.255 (203.0.0.0/8)
* 204.0.0.0 - 204.255.255.255 (204.0.0.0/8)
* 205.0.0.0 - 205.255.255.255 (205.0.0.0/8)
* 206.0.0.0 - 206.255.255.255 (206.0.0.0/8)
* 207.0.0.0 - 207.255.255.255 (207.0.0.0/8)
* 208.0.0.0 - 208.255.255.255 (208.0.0.0/8)
* 209.0.0.0 - 209.255.255.255 (209.0.0.0/8)
* 210.0.0.0 - 210.255.255.255 (210.0.0.0/8)
* 211.0.0.0 - 211.255.255.255 (211.0.0.0/8)
* 212.0.0.0 - 212.255.255.255 (212.0.0.0/8)
* 213.0.0.0 - 213.255.255.255 (213.0.0.0/8)
* 214.0.0.0 - 214.255.255.255 (214.0.0.0/8)
* 215.0.0.0 - 215.255.255.255 (215.0.0.0/8)
* 216.0.0.0 - 216.255.255.255 (216.0.0.0/8)
* 217.0.0.0 - 217.255.255.255 (217.0.0.0/8)
* 218.0.0.0 - 218.255.255.255 (218.0.0.0/8)
* 219.0.0.0 - 219.255.255.255 (219.0.0.0/8)
* 220.0.0.0 - 220.255.255.255 (220.0.0.0/8)
* 221.0.0.0 - 221.255.255.255 (221.0.0.0/8)
* 222.0.0.0 - 222.255.255.255 (222.0.0.0/8)
* 223.0.0.0 - 223.255.255.255 (223.0.0.0/8)
* 224.0.0.0 - 224.255.255.255 (224.0.0.0/8)
* 225.0.0.0 - 225.255.255.255 (225.0.0.0/8)
* 226.0.0.0 - 226.255.255.255 (226.0.0.0/8)
* 227.0.0.0 - 227.255.255.255 (227.0.0.0/8)
* 228.0.0.0 - 228.255.255.255 (228.0.0.0/8)
* 229.0.0.0 - 229.255.255.255 (229.0.0.0/8)
* 230.0.0.0 - 230.255.255.255 (230.0.0.0/8)
* 231.0.0.0 - 231.255.255.255 (231.0.0.0/8)
* 232.0.0.0 - 232.255.255.255 (232.0.0.0/8)
* 233.0.0.0 - 233.255.255.255 (233.0.0.0/8)
* 234.0.0.0 - 234.255.255.255 (234.0.0.0/8)
* 235.0.0.0 - 235.255.255.255 (235.0.0.0/8)
* 236.0.0.0 - 236.255.255.255 (236.0.0.0/8)
* 237.0.0.0 - 237.255.255.255 (237.0.0.0/8)
* 238.0.0.0 - 238.255.255.255 (238.0.0.0/8)
* 239.0.0.0 - 239.255.255.255 (239.0.0.0/8)
* 240.0.0.0 - 240.255.255.255 (240.0.0.0/8)
* 241.0.0.0 - 241.255.255.255 (241.0.0.0/8)
* 242.0.0.0 - 242.255.255.255 (242.0.0.0/8)
* 243.0.0.0 - 243.255.255.255 (243.0.0.0/8)
* 244.0.0.0 - 244.255.255.255 (244.0.0.0/8)
* 245.0.0.0 - 245.255.255.255 (245.0.0.0/8)
* 246.0.0.0 - 246.255.255.255 (246.0.0.0/8)
* 247.0.0.0 - 247.255.255.255 (247.0.0.0/8)
* 248.0.0.0 - 248.255.255.255 (248.0.0.0/8)
* 249.0.0.0 - 249.255.255.255 (249.0.0.0/8)
* 250.0.0.0 - 250.255.255.255 (250.0.0.0/8)
* 251.0.0.0 - 251.255.255.255 (251.0.0.0/8)
* 252.0.0.0 - 252.255.255.255 (252.0.0.0/8)
* 253.0.0.0 - 253.255.255.255 (253.0.0.0/8)
* 254.0.0.0 - 254.255.255.255 (254.0.0.0/8)
* 255.0.0.0 - 255.255.255.255 (255.0.0.0/8)