IP Address Lookup
Get hostname and Geo location
info for any IP



Help
Whois Lookup
Get contact info for a domain/ip
Help
Traceroute
Shows network route to host
Your iP is: 216.73.216.220 United States Near: United States

This is where you are:

IP Information - 216.73.216.220

Host name: 216.73.216.220

Country: United States

Country Code: US

Region:

City:

Latitude: 37.751

Longitude: -97.822

LEMOINE is reporting 94.46.251.10

ENGLISH VERSION : RECEIPT again these same emails stolen French LA POSTE using ( again ) emails boxes and IP Address of Society butler-shepherd.employerco.org.uk et hostingservice.com et ATOS.fr FRANÇAIS : RECEPTION mêmes emails d'escroqueries usurpant ENCORE LA POSTE en France avec adresses emails bidons en FREE.fr via les mails boxes of Society butler-shepherd.employerco.org.uk et hostingservice.com et ATOS.fr Bonjour Webmasters de LAPOSTE.net, et SIGNAL SPAM, Signal-Arnaques.com, et alertespam@labanquepostale.fr et abuse@ripe.net et hostmaster@ripe.net et abuse@atosorigin.fr et abuse@butler-shepherd.employerco.org.uk et abuse@google.com et abuse@gmail.com et network-abuse@google.com et arin-contact@google.com et Adresse email pour enquêtes-suivis de NEW SCOTLAND YARD : report@phishing.gov.uk Et celà continue toujours fin Janvier 2022 et ceci depuis au moins +16 années ( emails tous archivés complets avec tous leurs codes HTML depuis 2007 )( il y a forcément des complicités, du laxisme, des incompétents d’Etats et Services Administratifs chez des fournisseurs d’accès, depuis toutes ces +15 années que celà dure ! Ces escrocs ont vraiment la belle vie pour sévir en France ! Ce Mercredi 26 Janvier 2022 après 15h22 ( et très souvent aussi les week-ends, et très souvent aussi les nuits, avant ou après les horaires des Bureaux et Administrations en France, méthodes de faux-culs et d’escrocs ) j'ai encore reçu sur ma boite email ce même email d’escroqueries avec faux contenu de LAPOSTE et venant de l'adresse email FREE bidon ou usurpée,volée : z05ftlu.q0auevcv1n@free.fr et dragoesdiario@com.fcporto.pt Les adresses IP utilisées par le PC ou Smartphone de ce(s) batards de hackers fous, têtus, butés, et analphabètes ( incapables d’écrire correctement le Français depuis + 16 années ) sont multiples et préparés,envoyés en différés du Friday 17 Décembre 2021, pour brouiller les pistes, pour ne pas être tracés par des commandes Traceroute sur leurs adresses IP en direct ( bandes de poules mouillées, fumiers, trouillards ! ) : Received : from ts201-smtpin78.ddc.teliasonera.net (butler-shepherd.employerco.org.uk [193.233.190.171]) by mlpnf0116.laposte.net (SMTP Server) with ESMTP id 4JkQsl4MmVz1GBw6 for <@laposte.net>; Wed, 26 Jan 2022 15:22:35 +0100 (CET) Received : from msfrf2610.sfr.fr (msfrf2610.priv.atos.fr [10.18.203.24]) by msfrb1609 with LMTPA; Fri, 17 Dec 2021 09:21:17 +0100 Received : from smtp010.1-hostingservice.com (smtp010.1-hostingservice.com [94.46.251.10]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by msfrf2610.sfr.fr (SMTP Server) with ESMTPS id 4JFhlK00DKz1LQRwD for <soaresafonso.cathy@neuf.fr>; Fri, 17 Dec 2021 09:21:16 +0100 (CET) Received : from smtp010.1-hostingservice.com (mailserver24.1-hostingservice.com [94.46.251.34]) by smtp010.1-hostingservice.com (Postfix) with ESMTP id 3010845191 for <soaresafonso.cathy@neuf.fr>; Fri, 17 Dec 2021 08:21:16 +0000 (WET) IP Lookup Details: IP Information - 193.233.190.171 Host name: butler-shepherd.employerco.org.uk Country: Russian Federation Country Code: RU Region: 30 City: Khabarovsk Latitude: 48.4808 Longitude: 135.0928 IP Lookup Details: IP Information - 94.46.251.10 Host name: smtp010.1-hostingservice.com Country: Portugal Country Code: PT Region: 17 City: Matosinhos Latitude: 41.1821 Longitude: -8.6891 utilisant les boites emails des Sociétés butler-shepherd.employerco.org.uk et hostingservice.com et ATOS.fr et les serveurs IP de ces Sociétés. C'est visiblement et clairement une tentative de phishing et fraude ( fautes de grammaire multiples )

IP identified as: Hackers IP, Reported on: 26th, Jan. 2022
LEMOINE is reporting 149.72.37.212

ENGLISH: RECEIPT lots of emails stolen Society AMAZON and using again emails boxes of Society SENDGRID.net For Webmasters : FOR YOUR ACTIONS against these bastards hackers ! VERSION FRANÇAISE : RECEPTION mêmes emails d’escroqueries usurpant ENCORE AMAZON.fr vers les boites emails à LAPOSTE.net utilisant encore des boites emails SENDGRID.net : Bonjour Webmasters de SIGNAL SPAM, LA POSTE.net ( alertespam@labanquepostale.fr ) et AMAZON.com, et SENDGRID.net, et Signal Arnaques, ec2-abuse@amazon.com , stop-spoofing@amazon.com , abuse@ripe.net , hostmaster@ripe.net et abuse@sendgrid.net And FBI Services in hidden copy ( https://complaint.ic3.gov/default.aspx ) Et celà continue encore fin Janvier 2022 et ceci depuis au moins +16 années ( emails tous archivés complets avec tous leurs codes HTML depuis 2007 )( il y a forcément des complicités, du laxisme, des incompétents d’Etats et Services Administratifs chez des fournisseurs d’accès, depuis toutes ces +16 années que celà dure ! Ces escrocs ont la belle vie pour sévir en France ! Jeudi 27 Janvier 2022 après 06h33 ( et très souvent aussi les nuits, les week-ends ) j'ai ENCORE reçu sur ma boite mail LA POSTE.net ces nouveaux emails ci-dessous d’escroqueries usurpant AMAZON.com et venant cette fois-ci des adresses emails d’escroqueries: bounces+2208164526b@em1671.practisis.com Et seguimiento@practisis.com Les adresses IP utilisées par le PC ou smartphone de ces hackers fous sont multiples pour brouiller les pistes : 149.72.37.212 à DENVER aux U.S.A Received : from wrqvnrdq.outbound-mail.sendgrid.net (wrqvnrdq.outbound-mail.sendgrid.net [149.72.37.212]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by mlpnf0107.laposte.net (SMTP Server) with ESMTPS id 4Jkq4n3r94z1qqj3 for <@laposte.net>; Thu, 27 Jan 2022 06:33:29 +0100 (CET) DKIM-Signature : v=1; a=rsa-sha256; c=relaxed/relaxed; d=practisis.com; h=mime-version:from:subject:content-type:content-transfer-encoding:to; s=s1; bh=wjS/huXFnXll7gHeRZGzyXGvbn8pbF6aeKnPn789I7k=; b=F+LM3vLqX88Q2DMX9ecKdbFQn0cfnQXTXNPQIpRIwC0QK1EPdWQpGtGAx35jezT1TTer q050HB2ot/EbY52j448RA+CfbRhzTmqGQlHZtZNeGpKcLKHr6blRrvYuxYPTxGRZ5BxIKW kS40qagZ/Mb0rBN/1wFjObZ2Mo3rIlI1TF4Z7Ib+Os1ShZ+35sSU4areFxDblbqLiInuuE 0BAiLfPb4fu5lRQGJITZNpnKpMMcTS5ULvOSArZCwDeFode1rkaBb3dQeEFY4EN01jX6pI SlzeKgpylJRpXb/+v6Rsql+/ijpCAStYBzJOSOBS4RKs9nmsJk21SRUKCavHavaQ== Received : by filterdrecv-656998cfdd-dxhv8 with SMTP id filterdrecv-656998cfdd-dxhv8-1-61F22EA7-1D 2022-01-27 05:33:27.56540323 +0000 UTC m=+10994769.443342733 Received : from 5CD1350GXD (unknown) by geopod-ismtpd-5-2 (SG) with ESMTP id HGL0AOC-QYeuRYTMeMfHhw IP Lookup Details: IP Information - 149.72.37.212 Host name: wrqvnrdq.outbound-mail.sendgrid.net Country: United States Country Code: US Region: CO City: Denver Latitude: 39.7525 Longitude: -104.9995 Utilisant ENCORE des boites emails chez SENDGRID.net ( 149.72.37.212 ) Je n’ai rien chez AMAZON. C'est clairement une tentative d’escroquerie

IP identified as: Hackers IP, Reported on: 27th, Jan. 2022
er-Haugh is reporting /lookup_whois.php

Die kostenlose Singlebörse mit Single Dating Chat, Partnersuche , Kontaktanzeigen für Single. Finde Singles in ganz Deutschland. Free Dating Site. Over40 Friends Date is the best dating site for people over 40 because it is a completely free dating site, easy to use, easy to communicate, I did get some dates while using online dating sites, and I'amma to use them for a long time. Cause I just want to figure out sex bettween men and women, and https://goo.su/aHgc Dating männliche Bodybuilder Speed-Dating in meiner Nähe, Mädchen Dating-Site für 70-Jährige kostenlose Dating-Websites für junge erwachsene Jungen und Mädchen

Reported on: 27th, Jan. 2022
LEMOINE is reporting 193.233.177.68

ENGLISH: RECEIPT lots of emails stolen Society AMAZON and using again emails boxes of Society teliasonera.net For Webmasters : FOR YOUR ACTIONS against these bastards hackers ! VERSION FRANÇAISE : RECEPTION mêmes emails d’escroqueries usurpant ENCORE AMAZON.fr vers les boites emails à LAPOSTE.net utilisant encore des boites emails SENDGRID.net : Bonjour Webmasters de SIGNAL SPAM, LA POSTE.net ( alertespam@labanquepostale.fr ) et AMAZON.com, et SENDGRID.net, et Signal Arnaques, ec2-abuse@amazon.com , stop-spoofing@amazon.com , abuse@ripe.net , hostmaster@ripe.net And FBI Services in hidden copy ( https://complaint.ic3.gov/default.aspx ) Et celà continue encore fin Janvier 2022 et ceci depuis au moins +16 années ( emails tous archivés complets avec tous leurs codes HTML depuis 2007 )( il y a forcément des complicités, du laxisme, des incompétents d’Etats et Services Administratifs chez des fournisseurs d’accès, depuis toutes ces +16 années que celà dure ! Ces escrocs ont la belle vie pour sévir en France ! Jeudi 27 Janvier 2022 après 11h23 ( et très souvent aussi les nuits, les week-ends ) j'ai ENCORE reçu sur ma boite mail LA POSTE.net ces nouveaux emails ci-dessous d’escroqueries usurpant AMAZON.com et venant cette fois-ci des adresses emails d’escroqueries: wilt6i2lik.wzybdd@FREE.FR Et newsletters@email.businessoffashion.com Les adresses IP utilisées par le PC ou smartphone de ces hackers fous sont multiples pour brouiller les pistes : 193.233.177.68 en RUSSIE et 223.165.112.138 Received : from ts201-smtpin78.ddc.teliasonera.net (macdonald.custommetro.co.uk [193.233.177.68]) by mlpnf0108.laposte.net (SMTP Server) with ESMTP id 4JkxVB08C5znTfH for <ele.lemoine@laposte.net>; Thu, 27 Jan 2022 11:22:25 +0100 (CET) Original-recipient : rfc822;zakariae.atrari@icloud.com Received : from st11p00im-ztav05242001.me.com by p37-mailgateway-smtp-687bc68b96-kk2t6 (mailgateway 2207B140) with SMTP id 032767ad-63f7-46f9-bf2b-a23bbd175185 for <zakariae.atrari@icloud.com>; Wed, 26 Jan 2022 06:28:02 GMT X-Apple-MoveToFolder : INBOX X-Apple-Action : MOVE_TO_FOLDER/INBOX X-Apple-UUID : 032767ad-63f7-46f9-bf2b-a23bbd175185 Received : from 223.165.112.138.jfk.braze.com (223.165.112.138.jfk.braze.com [223.165.112.138]) by st11p00im-ztav05242001.me.com (Postfix) with ESMTPS id 8E808461E0D for <zakariae.atrari@icloud.com>; Wed, 26 Jan 2022 06:28:00 +0000 (UTC) IP Lookup Details: IP Information - 193.233.177.68 Host name: macdonald.custommetro.co.uk Country: Russian Federation Country Code: RU Region: 30 City: Khabarovsk Latitude: 48.4808 Longitude: 135.0928 Utilisant ENCORE des boites emails chez SENDGRID.net ( 149.72.37.212 ) Je n’ai rien chez AMAZON. C'est clairement une tentative d’escroquerie

IP identified as: Hackers IP, Reported on: 27th, Jan. 2022
LEMOINE is reporting 223.165.112.138

ENGLISH: RECEIPT lots of emails stolen Society AMAZON and using again emails boxes of Society teliasonera.net For Webmasters : FOR YOUR ACTIONS against these bastards hackers ! VERSION FRANÇAISE : RECEPTION mêmes emails d’escroqueries usurpant ENCORE AMAZON.fr vers les boites emails à LAPOSTE.net utilisant encore des boites emails SENDGRID.net : Bonjour Webmasters de SIGNAL SPAM, LA POSTE.net ( alertespam@labanquepostale.fr ) et AMAZON.com, et SENDGRID.net, et Signal Arnaques, ec2-abuse@amazon.com , stop-spoofing@amazon.com , abuse@ripe.net , hostmaster@ripe.net And FBI Services in hidden copy ( https://complaint.ic3.gov/default.aspx ) Et celà continue encore fin Janvier 2022 et ceci depuis au moins +16 années ( emails tous archivés complets avec tous leurs codes HTML depuis 2007 )( il y a forcément des complicités, du laxisme, des incompétents d’Etats et Services Administratifs chez des fournisseurs d’accès, depuis toutes ces +16 années que celà dure ! Ces escrocs ont la belle vie pour sévir en France ! Jeudi 27 Janvier 2022 après 11h23 ( et très souvent aussi les nuits, les week-ends ) j'ai ENCORE reçu sur ma boite mail LA POSTE.net ces nouveaux emails ci-dessous d’escroqueries usurpant AMAZON.com et venant cette fois-ci des adresses emails d’escroqueries: wilt6i2lik.wzybdd@FREE.FR Et newsletters@email.businessoffashion.com Les adresses IP utilisées par le PC ou smartphone de ces hackers fous sont multiples pour brouiller les pistes : 193.233.177.68 en RUSSIE et 223.165.112.138 en AUSTRALIE Received : from ts201-smtpin78.ddc.teliasonera.net (macdonald.custommetro.co.uk [193.233.177.68]) by mlpnf0108.laposte.net (SMTP Server) with ESMTP id 4JkxVB08C5znTfH for <ele.lemoine@laposte.net>; Thu, 27 Jan 2022 11:22:25 +0100 (CET) Original-recipient : rfc822;zakariae.atrari@icloud.com Received : from st11p00im-ztav05242001.me.com by p37-mailgateway-smtp-687bc68b96-kk2t6 (mailgateway 2207B140) with SMTP id 032767ad-63f7-46f9-bf2b-a23bbd175185 for <zakariae.atrari@icloud.com>; Wed, 26 Jan 2022 06:28:02 GMT X-Apple-MoveToFolder : INBOX X-Apple-Action : MOVE_TO_FOLDER/INBOX X-Apple-UUID : 032767ad-63f7-46f9-bf2b-a23bbd175185 Received : from 223.165.112.138.jfk.braze.com (223.165.112.138.jfk.braze.com [223.165.112.138]) by st11p00im-ztav05242001.me.com (Postfix) with ESMTPS id 8E808461E0D for <zakariae.atrari@icloud.com>; Wed, 26 Jan 2022 06:28:00 +0000 (UTC) IP Lookup Details: IP Information - 193.233.177.68 Host name: macdonald.custommetro.co.uk Country: Russian Federation Country Code: RU Region: 30 City: Khabarovsk Latitude: 48.4808 Longitude: 135.0928 IP Lookup Details: IP Information - 223.165.112.138 Host name: 223.165.112.138.jfk.braze.com Country: Australia Country Code: AU Region: City: Latitude: -33.494 Longitude: 143.2104 Utilisant ENCORE des boites emails chez teliasonera.net ( 193.233.177.68 ) et jfk.braze.com [223.165.112.138] Je n’ai rien chez AMAZON. C'est clairement une tentative d’escroquerie ! ( fautes d’orthographes, etc ) ************************** CODES HTML ci-dessous ************************************** Return-Path : <wilt6i2lik.wzybdd@FREE.FR> Received : from mlpnf0108.laposte.net (mlpnf0108.sys.meshcore.net [10.94.128.87]) by mlpnb0108 with LMTPA; Thu, 27 Jan 2022 11:23:36 +0100 X-Cyrus-Session-Id : cyrus-123883-1643279016-5-17404987973724733756 X-Sieve : CMU Sieve 3.0 X-mail-filterd : {"version":"1.3.4","queueID":"4JkxW64mzRznV8G","contextId":"78282a03-f09e-49c4-874c-1d80c274377a"} X-ppbforward : {"queueID":"4JkxW64mzRznV8G","server":"mlpnf0108"} Received : from outgoing-mail.laposte.net (localhost.localdomain [127.0.0.1]) by mlpnf0108.laposte.net (SMTP Server) with ESMTP id 4JkxW64mzRznV8G for <lpn000000000000000018870443@back01-mail02-04.lpn.svc.meshcore.net>; Thu, 27 Jan 2022 11:23:14 +0100 (CET) X-mail-filterd : {"version":"1.3.4","queueID":"4JkxVB08C5znTfH","contextId":"13caa203-cc69-47fd-a786-b50fd744b75e"} X-lpn-mailing : SPAM X-lpn-spamrating : 62 X-lpn-spamlevel : low Authentication-Results : laposte.net; spf=neutral smtp.mailfrom=wilt6i2lik.wzybdd@FREE.FR smtp.helo=ts201-smtpin78.ddc.teliasonera.net; dkim=fail reason="bad signature" header.d=email.businessoffashion.com header.s=scph1220 header.b=giYkWV; dmarc=fail reason="SPF is not aligned, DKIM is not aligned" X-List-Unsubscribe : <https://clicks.businessoffashion.com/f/a/8eNjr_8ykmZsU43fR6-7jQ~~/AAAHagA~/RgRj027wP4QkAmh0dHBzOi8vMDEuZW1haWxpbmJvdW5kcHJvY2Vzc2luZy5ldS9lbWFpbC9tYW5hZ2Vfc3Vic2NyaXB0aW9ucy9iNHRkWklHNVVuV09oWFRtMXJ6dTBBJTNEJTNEJTI0WEszdGN2aEFqckxDUUJiYTk5eUFHdDVKM2s3TDdZS1QzWEJ4RFhpUzl5cyUzRD9kPWxvelZscWJjWXhBcWZLb0F0a1o1ZEElM0QlM0QlMjRIOW5IWlRpeGM3ckdrSGpZdHdXdnQzMW5YRWxGajFPVyUyQlJxYWhBZWI0aEZOMDFBRlFLbkxFSDVZdWppdCUwQU0lMkJxQkslMkZhWnY4RFdKdlFyTDRhZTU2OXpKR09tTG9xOGdQMThvYSUyQkhKZHh1Y3dJcG9MbVoxQWZkYm1kJTJCJTBBUngwaTJoSzBDJTJCYTRVbDlJeWUxcUh4eEFyMFpSRyUyQkZQTiUyRkNGZm5xUjlrcHMwOFl2a0czZyUyQnIlMkJ4S0F5JTJGJTBBMyUyRndDUFZaNGhWTERpbjd0b2FxZDVsUFNhRVVEOVQ2elE5ZWFyJTJCcWJ2RVkwOTgwWW9CbHVFQUZISHN1SCUwQXc4U0k2bjNLOXg3YTIlMkJ0Qk9uMzBDbWxCSGpwSGQ3QVFmb3B4Zm1remUlMkJkU0NVTVBqSXZoaVNwWCUyQlExUyUwQVlLOTclMkJuMmtCUHRjY1VEamRXc1cmMT0xVwVzcGNldUIKYeHw6fBhzGtSBVIaemFrYXJpYWUuYXRyYXJpQGljbG91ZC5jb21YBAAAACQ~> X-lpn-spamcause : OK, (150)(1000)gggruggvucftvghtrhhoucdtuddrgedvvddrfeefgdduhecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfntefrqffuvffgpdggtfgfnhhsuhgsshgtrhhisggvnecuuegrihhlohhuthemuceftddtnecuufhprghmkfhppfgvthifohhrkhgprhhtucdludehtddmnecujfgurhepvffkffgtgghruffhsegrtderredttdejnecuhfhrohhmpedfffgvqdfnohhnghhhihdfuceonhgvfihslhgvthhtvghrshesvghmrghilhdrsghushhinhgvshhsohhffhgrshhhihhonhdrtghomheqnecuggftrfgrthhtvghrnhepkeekvdfgteeufeejgfdujeduvedvueevtdeuhfeugeejfeetvddtjedtveehleefnecuffhomhgrihhnpehkihhnughlvghmohhvvgdruhhknecukfhppeduleefrddvfeefrddujeejrdeikedpvddvfedrudeihedrudduvddrudefkeenucevlhhushhtvghrufhiiigvpeejfeefjeenucfrrghrrghmpehinhgvthepudelfedrvdeffedrudejjedrieekpdhhvghlohepthhsvddtuddqshhmthhpihhnjeekrdguuggtrdhtvghlihgrshhonhgvrhgrrdhnvghtpdhmrghilhhfrhhomhepfihilhhtiehivdhlihhkrdifiiihsgguugeshfftgffgrdfhtfdpnhgspghrtghpthhtohepuddprhgtphhtthhopegvlhgvrdhlvghmohhinhgvsehlrghpohhsthgvrdhnvght Received : from ts201-smtpin78.ddc.teliasonera.net (macdonald.custommetro.co.uk [193.233.177.68]) by mlpnf0108.laposte.net (SMTP Server) with ESMTP id 4JkxVB08C5znTfH for <ele.lemoine@laposte.net>; Thu, 27 Jan 2022 11:22:25 +0100 (CET) Original-recipient : rfc822;zakariae.atrari@icloud.com Received : from st11p00im-ztav05242001.me.com by p37-mailgateway-smtp-687bc68b96-kk2t6 (mailgateway 2207B140) with SMTP id 032767ad-63f7-46f9-bf2b-a23bbd175185 for <zakariae.atrari@icloud.com>; Wed, 26 Jan 2022 06:28:02 GMT X-Apple-MoveToFolder : INBOX X-Apple-Action : MOVE_TO_FOLDER/INBOX X-Apple-UUID : 032767ad-63f7-46f9-bf2b-a23bbd175185 Received : from 223.165.112.138.jfk.braze.com (223.165.112.138.jfk.braze.com [223.165.112.138]) by st11p00im-ztav05242001.me.com (Postfix) with ESMTPS id 8E808461E0D for <zakariae.atrari@icloud.com>; Wed, 26 Jan 2022 06:28:00 +0000 (UTC) X-ICL-SCORE : 3.3330332300 X-ICL-INFO : GAtbVUseBVFGSVVESgMGUldZCh4MXUMRSFsIVVhDQ19XFwkZHRIWBxFERBoLQEQUBkhbRkEABFc5 PQJCDXxCEkgbCQIWU1MRWEheTkAdBVQ1HAsWEVwYAAAKDxkdQ0UNEx8HBBBZWQxbGgkaWhBQBkhb AxoZWVpMFwwVHhZVRREaHwAWC1hfDRtXBRgVEhYRHAlbVUoCBUxET1NZSQEETERKXlVYWFMOGkRE RUoDGFNDTEhGSQIYU0ZBSB0eWxgABxgcElZTWQ9XWRYDCg0UUEdKSEZOBRhTREtIRksIGAgTEkgV ClFMB1saCRpaEFIGSFsDGhlZWkwXDBUeFlVFERofABYLWF8NG1cFGBUSFg8cHVtVRAIDTEBJSEZM BwVRW0kgTj0AcFNDOQcfVl1CA0YPFBILRBgBFlcWBRweRRIUCw0HF0NCXFdZFBRFEkwDHhgUHhlV GAMBCwcFEXBfARkWExNWU1kPVw== Authentication-Results : dmarc.icloud.com; dmarc=pass header.from=email.businessoffashion.com x-dmarc-info : pass=pass; dmarc-policy=none; s=r1; d=r1 x-dmarc-policy : v=DMARC1; p=none; sp=none; rua=mailto:re+222b013434df@inbound.dmarcdigests.com; pct=100 Authentication-Results : dkim-verifier.icloud.com; dkim=pass (1024-bit key) header.d=email.businessoffashion.com header.i=@email.businessoffashion.com header.b=giYkWV73 Authentication-Results : spf.icloud.com; spf=pass (spf.icloud.com: domain of msprvs1=19025LDd5uLtp=bounces-1898-36@email.businessoffashion.com designates 223.165.112.138 as permitted sender) smtp.mailfrom="msprvs1=19025LDd5uLtp=bounces-1898-36@email.businessoffashion.com" Received-SPF : pass (spf.icloud.com: domain of msprvs1=19025LDd5uLtp=bounces-1898-36@email.businessoffashion.com designates 223.165.112.138 as permitted sender) receiver=spf.icloud.com; client-ip=223.165.112.138; helo=223.165.112.138.jfk.braze.com; envelope-from="msprvs1=19025LDd5uLtp=bounces-1898-36@email.businessoffashion.com" X-MSFBL : WcIxsoND4pA0GaIpKCH/82CKDzk6OlfD7e+YJov/ZDA=|eyJtZXNzYWdlX2lkIjo iNjFlMWYwZTlmMDYxY2M2YjUyMDUiLCJyIjoiemFrYXJpYWUuYXRyYXJpQGljbG9 1ZC5jb20iLCJ0ZW5hbnRfaWQiOiJzcGNldSIsInN1YmFjY291bnRfaWQiOiIzNiI sImN1c3RvbWVyX2lkIjoiMTg5OCJ9 DKIM-Signature : v=1; a=rsa-sha256; c=relaxed/relaxed; d=email.businessoffashion.com; s=scph1220; t=1643178480; i=@email.businessoffashion.com; bh=/T429KyzSpGUI5ALh9CwzY0/Cv6pLtCR4Fg8FC6i++A=; h=To:Message-ID:Date:Content-Type:Subject:From; b=giYkWV739B91Z9qzQaNvDDr7lo1cHtLEq7kq/93c+c+rSWPautyAkJMYiJMBwO8st vSTkCuaWpM+6wUh5hg1QWKxBDu3QV8qv11uyluBPq9z9iq2e2igJYgZNGvAvb9TZbm Q0QKpsjuzYivwXArspQEhMp6D0KccZ+86sBpal2c= To : ele.lemoine@laposte.net Message-ID : <25.50.14733.0F9E0F16@ah.mta3vrest.cc.prd.sparkpost> Date : Wed, 26 Jan 2022 06:28:00 +0000 Content-Type : multipart/alternative; boundary="_----VzWExtE4IroIwPy4YboM+g===_05/50-14733-0F9E0F16" MIME-Version : 1.0 Reply-To : newsletter@businessoffashion.com Subject : Re: Courez la chance de prendre un De-longhi G R A T U I T From : "De-Longhi" <newsletters@email.businessoffashion.com> X-MANTSH : 1TEIXWV4bG1oaGkNHB1BeSF8aHBsTHhIaGxEKTEMXGxoEHRwEGxMTBBIQGx4aHxo RCkxZFxIcEQpZRBdia1xfG1h/eBh4UhEKWU0XZEVETxEKWUkXGnEaEBp3BhwccRsaHB4QGBkZd wYYGgYaEQpZXhdsbHkRCkNOF0JzZx1jBWZpXx14fx5tfXNlH0ZgaW9jckhYfx0ZcB9ZEQpYXBc ZBBoEHh8HSxsbGxwaTxwFGxoEGxIYBBgbGQQbHRAbHhofGhEKXlkXcGBFHGYRCk1cFxoRCkxaF 3hlXUFNEQpFWRdoa3MRCkxfF3oFBQUFBQUFBRNGEQpMRhdja2sRCkNaFxgYGQQbHB8EGxsYBBs ZEhEKQl4XGxEKQlwXGxEKQksXelBtHGUdewFaQQERCkJJF2tZeHodbVh+ex54EQpCRRdsH2d5U mRbbRtaAREKQk4Xa1l4eh1tWH57HngRCkJMF2tJR3AfSE9ieHgZEQpCbBdiT2tEZ25HZEcZfhE KQkAXbWZLf1xQEm9FQWgRCkJYF2RjXntFaEZCf11fEQpNXhcbEQpaWBcbEQpwZxdoRx9Qf0kcY gUdbRAcGhEKcGgXbl1mX21nbUldblAQGhEKcGgXZx1Of2EYAUR8ZVwQGhEKcGgXZXwcbF5mU1t 5a0MQGhEKcGgXZVJuc0BAZGUFHUYQGhEKcGgXaFBSGX4bHH4TE1IQGhEKcH0XZEdgYkBvQWlZR RgQGhEKcH0XbUtLcBh5c1pYTHsQGhEKcH0XbGttRwFzehtsY0YQGhEKcH0XYx97WAV7TllSbEI QGhEKcH0XbmUfR29BfwF5TWsQGhEKcH0Xbn9IZmdgWgEeGWcQGhEKcH0XYnlGGEdsZHBfAV0QG hEKcH0XZl0abV9ySRlSf1IQGhEKcH0XY1BCGkJ6aV8eH2kQGhEKcH0XYBNsUBh7R3wScmQQGhE KcH0Xek5gHW95bFJ8UlwQGhEKcH0Xb29jaUwBHHlzbHwQGhEKcH0XbUIaZG5dWEtsQEgQGhEKc H0XZEx/HRkFGU8eTxoQGhEKcH0XbRtQfFlDW2BPZxMQGhEKcH0Xb0ZjR2d8YnoZWE4QGhEKcH0 XelsZTmh9Zll/EkAQGhEKcH0XZ3BAbF18HRJbZG0QGhEKcH0Xb0ZubFpMc3sSEmEQGhEKcH0XY HhYSBJ7WmEcYQUQGhEKcH8XY1NbHUFtf3lhZ0cQGBgRCnBfF2tJb0REYVBzWVt9EBoRCnBfF21 raW1neGFJUEB9EBoRCnBfF2Jnex1SYR0eb0F8EBoRCnBfF2lMU3p8ZRMSa3JjEBoRCnBfF25NH 2QaenwbHRoZEBoRCnBfF21zaX8bXm8TZRsTEBoRCnBfF21BfRt9aVpwRkFAEBoRCnBfF29EWG5 wYk1mckRoEBoRCnBfF2ZOZBJ/QxhSGE4TEBoRCnBfF2IZfRJHe3l4GFxbEBoRCnBfF2dDARoZH XhgH39AEBoRCnBfF2lOZX9+H2gbZxlmEBoRCnBfF2EcWU9yHUtZfF9PEBoRCnBfF2tScE9MZ2B PARl+EBoRCnBfF3pkARxGe0FHUHABEBoRCnBfF29iAXlyfhpHARkYEBoRCnBfF2F4UB8FUEEZB VseEBoRCnBfF2IBGh5QARJmGGB7EBoRCnBfF3pQE159Y3JDa2BuEBoRCnBfF2lYEhljb0F8Zkh oEBoRCnBsF2F8fkEZcnNOYhseEB4SEQptfhcbEQpYTRdLEQ== X-CLX-Shades : None

IP identified as: Hackers IP, Reported on: 27th, Jan. 2022
GeorgeMAP is reporting luckyshamrocks.info

Очень большой ассортимент,советую заехать в один из их магазинов

Reported on: 27th, Jan. 2022
DavidAverm is reporting /lookup_whois.php

八千代醫美集團 https://yachiyo.com.tw/

Reported on: 27th, Jan. 2022
James is reporting 167.71.248.31

This Address took over my windows 10 DNS! block NOW!

IP identified as: Wireless IP, Reported on: 27th, Jan. 2022
Andy Whitehead is reporting 109.249.185.228

this ip is constantly carrying out UDP port scan attacks on my router

IP identified as: Hackers IP, Reported on: 27th, Jan. 2022
Ninja is reporting 213.35.152.234

This IP proudly,"removed all the junk".

IP identified as: Other, Reported on: 27th, Jan. 2022
JamesSeamb is reporting /lookup_whois.php

第一借錢網-借錢,小額借款,小額借錢,證件借款,證件借錢,身分證借款,身分證借錢 https://168cash.com.tw/

Reported on: 28th, Jan. 2022
EverettSlody is reporting /lookup_whois.php

Внимание - внимание. Супер акционное предложение. Таких цен вы ещё не видели! https://www.admdental.ru https://srubrussia.ru https://skoda-s-auto.ru

Reported on: 28th, Jan. 2022
Jios is reporting 198.98.60.152

Attack to my site

IP identified as: Hackers IP, Reported on: 28th, Jan. 2022
jsa associates is reporting 87.251.67.98

please block this ip http://87.251.67.98/ error reports Report For - Quick Heal Intrusion Detection & Prevention Friday, 28 January, 2022, Time 19:05:21 Quick Heal Version - 19.00 Virus database - 28 January 2022 -------------------------------------------------------------------- Action Taken: Blocked Vulnerability detected: RDP brute force attack. Description: Brute force attack on remote desktop protocol. References: RDP brute force attack detected.

IP identified as: Hackers IP, Reported on: 28th, Jan. 2022
Abhi is reporting 106.198.222.19

I

IP identified as: Mobile device IP, Reported on: 28th, Jan. 2022
EverettSlody is reporting /lookup_whois.php

Внимание - внимание. Супер акционное предложение. Таких цен вы ещё не видели! https://srubrussia.ru https://www.admdental.ru https://skoda-s-auto.ru

Reported on: 28th, Jan. 2022
jeff dowdy is reporting 173.205.176.179

Can you tell me why this IP is showing up on Hughes Net

IP identified as: Hackers IP, Reported on: 28th, Jan. 2022
jeff dowdy is reporting 173.205.176.179

Would you block this IP. It is the result of hackers. 173.205.176.179

IP identified as: Hackers IP, Reported on: 28th, Jan. 2022
Khalid is reporting 188.70.62.242

My divais in plis send me

IP identified as: Mobile device IP, Reported on: 28th, Jan. 2022
EverettSlody is reporting /lookup_whois.php

Внимание - внимание. Супер акционное предложение. Таких цен вы ещё не видели! https://srubrussia.ru https://skoda-s-auto.ru https://www.admdental.ru

Reported on: 29th, Jan. 2022
EverettSlody is reporting /lookup_whois.php

Внимание - внимание. Супер акционное предложение. Таких цен вы ещё не видели! https://skoda-s-auto.ru https://www.admdental.ru https://srubrussia.ru

Reported on: 29th, Jan. 2022
GeorgeMAP is reporting luckyshamrocks.info

Очень большой ассортимент,советую заехать в один из их магазинов

Reported on: 29th, Jan. 2022
LEMOINE is reporting 209.85.210.179

RECEIPT emails stolen EUROPOL using emails boxes Society Google with IP Address in U.S.A ! RECEPTION emails d'escroqueries usurpant EUROPOL en France avec adresses emails usurpées Google et adresse IP aux U.S.A : Bonjour Webmasters de LAPOSTE.net, SIGNAL SPAM, Signal-Arnaques.com, et Google, et abuse@ripe.net et hostmaster@ripe.net et alertespam@labanquepostale.fr et abuse@gmail.com et arin-contact@google.com et network-abuse@google.com Et fraude-bretic@interieur.gouv.fr And FBI Services in hidden copy ( https://complaint.ic3.gov/default.aspx ) Et celà continue encore fin Janvier 2022 ( idem Jeudi 06 Janvier 2021 à 03h15, et Lundi 15 Nov 2021 à 22h54, et Jeudi 09 Sept 2021 à 06h43 ) et ceci depuis de nombreux mois ( emails tous archivés complets avec tous leurs codes HTML )( il y a forcément des complicités, du laxisme, des incompétents d’Etats et Services Administratifs chez des fournisseurs d’accès, depuis toutes ces +15 années que celà dure ! Ces escrocs ont la belle vie pour sévir en France ! Ce Dimanche 30 Janvier 2022 après 04h45 ( très souvent aussi les week-ends, très souvent les nuits, avant ou après les horaires des Bureaux et Administrations en France, méthodes de faux-culs et d’escrocs ) et comme des milliers d’Internautes ( cf le site Internet Signal-Arnaques.com ) j'ai aussi reçu sur ma boite email ce même email d’escroqueries avec fichier .PNG faux contenu EUROPOL Christian Rodriguez et signé Catherine de BOLLE et venant des adresses emails bidons ou usurpées : gabriela.vazquez6@upr.edu et CAOosnWdw8ege1U1fAxCTAsNOuo2hTNV-WxnKH0YGJUFsKZCh_Q@mail.gmail.com Les adresses IP utilisées par le PC de ce(s) batards de hackers fous, débiles, têtus, butés, et analphabètes ( incapables d’écrire correctement le Français ) en cause sont : 209.85.210.179 aux U.S.A ! Received : from mail-pf1-f179.google.com (mail-pf1-f179.google.com [209.85.210.179]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by mlpnf0119.laposte.net (SMTP Server) with ESMTPS id 4JmcXV3stqzKm40 for <@laposte.net>; Sun, 30 Jan 2022 04:45:14 +0100 (CET) Received : by mail-pf1-f179.google.com with SMTP id a19so3828655pfx.4 for <@laposte.net>; Sat, 29 Jan 2022 19:45:14 -0800 (PST) IP Lookup Details: IP Information - 209.85.210.179 Host name: mail-pf1-f179.google.com Country: United States Country Code: US Region: City: Latitude: 37.751 Longitude: -97.822 utilisant encore des boites emails Google ! C'est visiblement et clairement une tentative de phishing et fraude ( fautes de grammaire multiples ) Ci-dessous cet email d’escroquerie avec ces en-têtes complets : *********** CONTENU du mail d’escroquerie *************** Courriel original COPJ • Aujourd'hui, à 04:45 (il y a 4 heures) 1017Ko • • • De : Gabriela M Vazquez Bristol • A : undisclosed-recipients:; • 1 pièce jointe • 00.png [1011Ko] o o Télécharger Télécharger SALUTATION Votre Maηdat eη fichier joiηt. ****************** Codes HTML complets ci-dessous ************************** Return-Path : <gabriela.vazquez6@upr.edu> Received : from mlpnf0119.laposte.net (mlpnf0119.sys.meshcore.net [10.94.128.98]) by mlpnb0108 with LMTPA; Sun, 30 Jan 2022 04:45:15 +0100 X-Cyrus-Session-Id : cyrus-227419-1643514315-2-7350528294128412638 X-Sieve : CMU Sieve 3.0 X-mail-filterd : {"version":"1.3.4","queueID":"4JmcXW5Dq5zKm3k","contextId":"f794dbcc-3f4a-4fb5-978d-6d8fa7d8341d"} X-ppbforward : {"queueID":"4JmcXW5Dq5zKm3k","server":"mlpnf0119"} Received : from outgoing-mail.laposte.net (localhost.localdomain [127.0.0.1]) by mlpnf0119.laposte.net (SMTP Server) with ESMTP id 4JmcXW5Dq5zKm3k for <lpn000000000000000018870443@back01-mail02-04.lpn.svc.meshcore.net>; Sun, 30 Jan 2022 04:45:15 +0100 (CET) X-mail-filterd : {"version":"1.3.4","queueID":"4JmcXV3stqzKm40","contextId":"cf8ff418-b6ba-437c-81bc-0467b21df587"} X-lpn-mailing : DCE X-lpn-spamrating : 60 X-lpn-spamlevel : low Authentication-Results : laposte.net; spf=pass smtp.mailfrom=gabriela.vazquez6@upr.edu smtp.helo=mail-pf1-f179.google.com; dkim=pass reason="good signature" header.d=upr.edu header.s=google header.b=WegFss; dmarc=pass reason="SPF is aligned, DKIM is aligned" X-lpn-spamcause : OK, (107)(12000)gggruggvucftvghtrhhoucdtuddrgedvvddrfeekgdegfecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfntefrqffuvffgpdggtfgfnhhsuhgsshgtrhhisggvnecuuegrihhlohhuthemuceftddtnecuuegrugftvghpuhhtqdfgmhgrihhlucdluddtjedmnecujfgurhepgghfjgfhfffkufgtsehmtderredttdejnecuhfhrohhmpefirggsrhhivghlrgcuofcugggriihquhgviicuuehrihhsthholhcuoehgrggsrhhivghlrgdrvhgriihquhgviieisehuphhrrdgvughuqeenucggtffrrghtthgvrhhnpefgteeftedtgeffffffhedvvdfhvdegkeduleevffdvjeehhfekheetkeegfeelkeenucfkphepvddtledrkeehrddvuddtrddujeelnecuuegrugftvghpuhhtgfhmrghilhepghgrsghrihgvlhgrrdhvrgiiqhhuvgiiieesuhhprhdrvgguuhenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedvtdelrdekhedrvddutddrudejledphhgvlhhopehmrghilhdqphhfuddqfhdujeelrdhgohhoghhlvgdrtghomhdpmhgrihhlfhhrohhmpehgrggsrhhivghlrgdrvhgriihquhgviieisehuphhrrdgvughupdhnsggprhgtphhtthhopedupdhrtghpthhtohepvghlvgdrlhgvmhhoihhnvgeslhgrphhoshhtvgdrnhgvthdpshhpfhepphgrshhspdgukhhimhepphgrshhspdgumhgrrhgtpehprghssh Received : from mail-pf1-f179.google.com (mail-pf1-f179.google.com [209.85.210.179]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by mlpnf0119.laposte.net (SMTP Server) with ESMTPS id 4JmcXV3stqzKm40 for <ele.lemoine@laposte.net>; Sun, 30 Jan 2022 04:45:14 +0100 (CET) Received : by mail-pf1-f179.google.com with SMTP id a19so3828655pfx.4 for <ele.lemoine@laposte.net>; Sat, 29 Jan 2022 19:45:14 -0800 (PST) DKIM-Signature : v=1; a=rsa-sha256; c=relaxed/relaxed; d=upr.edu; s=google; h=mime-version:references:in-reply-to:from:date:message-id:subject:to; bh=yll98YfbEA8sE9i9Tpb1k2/rCjv/4rT+4Rxbh1ryBgo=; b=WegFsskNbdXDAPqBa0gtQ2RU09Hga5OlRv/S1TVU89IY8DsLyEUYAMBWmQNaPwHBCc l788tUDl7nePgdK3t3vwCefqYjQDffSw3WMAzcVlaU2n3glF3SkG89Vz/Dl5+EvPOuYu 7UHEDyfO7EMEbAPv67dbQFB2lX0iPDhy4bF2I= X-Google-DKIM-Signature : v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20210112; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=yll98YfbEA8sE9i9Tpb1k2/rCjv/4rT+4Rxbh1ryBgo=; b=S6TguOhV99ErnkZMTdTpF+PPLdM6JSOgi7tiK54rgkg3pSl7THDzih1+0kBI0WgcTT GofIMaPwNdPXI0dYr6s+dE5i08a+0neCcUJdheWQcKLqr8PjYYtw4g7q5JcdCYzPTmg+ PnfJD+QcnZg0cY0NETbLOEBx0qXf2KkvCX5umOWgsPcEpJGxkeDFG7K7TdZjlwH596AP YKTfapgpQuDbSSmmWgByCASp9/zVBUwR092W62UmJzWyxbh+JWqivEiDbn5IPQBRLGYW TyqoFI0reM2M4C0L/tN1zGe07BXBgCVY/wbPgVi2Jftq0KdQ53oiInDWW9iYqGA/VkF8 VHMw== X-Gm-Message-State : AOAM532vaytlLzSIhtZj1iBNzixlOK4vDEEWPk+lMigT8KVQioSESddE udPS/A8KI0e8fpSLGME3s2gFRT4omyf6k9M8ETYBnBGleC+iEOs6yJY= X-Google-Smtp-Source : ABdhPJynO9XkH4a+2vrvQV55N/OsrEwPHmHMd1B3iuWjlRXwLd6zKLzPr870hg+RxSuZIEJPMc8aUXAFDZqXEutReSM= X-Received : by 2002:a05:6e02:d48:: with SMTP id h8mr9390462ilj.212.1643504762820; Sat, 29 Jan 2022 17:06:02 -0800 (PST) MIME-Version : 1.0 References : <CAOosnWeRfdb4eHZXzL6TJx1UvOrzeiHmQo3OpaqVbUaB_O=pug@mail.gmail.com> In-Reply-To : <CAOosnWeRfdb4eHZXzL6TJx1UvOrzeiHmQo3OpaqVbUaB_O=pug@mail.gmail.com> From : Gabriela M Vazquez Bristol <gabriela.vazquez6@upr.edu> Date : Sun, 30 Jan 2022 02:05:28 +0100 Message-ID : <CAOosnWdw8ege1U1fAxCTAsNOuo2hTNV-WxnKH0YGJUFsKZCh_Q@mail.gmail.com> Subject : Courriel original COPJ To : undisclosed-recipients:; Content-Type : multipart/mixed; boundary="0000000000009360c205d6c24508"

IP identified as: Hackers IP, Reported on: 30th, Jan. 2022
Wilco is reporting 193.56.29.112

SMTP Spam attack

Reported on: 30th, Jan. 2022
Bob is reporting 24.245.229.93

These hackers redirect from my home IP to this location.

IP identified as: Hackers IP, Reported on: 30th, Jan. 2022
Previous  400 401 402 403 404 405 406 407 408 409 410 Next 
Expand section List of Class A IP ranges (click to view)