Get hostname and Geo location
info for any IP



Whois Lookup
Get contact info for a domain/ip
Traceroute
Shows network route to host
Your iP is: 3.235.107.209 United States Near: Ashburn, Virginia, United States

This is where you are:

IP Information - 3.235.107.209

Host name: ec2-3-235-107-209.compute-1.amazonaws.com

Country: United States

Country Code: US

Region:

City:

Latitude: 37.751

Longitude: -97.822

alain lubat is reporting 80.12.242.127

I receive a fishing mail of this ip 86.12.242.127 which seems managed by your services. This is a scam, thank you for doing the necessary. here after the mail: Return-Path: <alain.lubat@orange.fr> Received: from smtp.smtpout.orange.fr ([80.12.242.127]) by mx.kundenserver.de (mxeue010 [212.227.15.41]) with ESMTPS (Nemesis) id 1MLyO9-1h8vM63d33-00HywN for <alain@almail.net>; Wed, 15 May 2019 13:06:55 +0200 Received: from opme11dob39nd1.rouen.francetelecom.fr ([10.110.50.216]) by mwinf5d09 with ME id Cb6v2000J4fsX0S03b6vGd; Wed, 15 May 2019 13:06:55 +0200 X-ME-Helo: opme11dob39nd1.rouen.francetelecom.fr X-ME-Date: Wed, 15 May 2019 13:06:55 +0200 X-ME-IP: 10.110.50.216 X-Sieve: Pigeonhole Sieve 0.4.24 (5a7e9e62) X-Sieve-Redirected-From: alain.lubat@orange.fr Received: from opme11dod16nd1.rouen.francetelecom.fr ([10.79.5.104]) by opme11dob39nd1.rouen.francetelecom.fr with LMTP id wEQqEs/y21xfewAAVm+2Zg ; Wed, 15 May 2019 13:06:55 +0200 Received: from opme11ppr07nd1.rouen.francetelecom.fr ([10.79.5.104]) by opme11dod16nd1.rouen.francetelecom.fr with LMTP id GIb6Ec/y21xvDAAASbndxA ; Wed, 15 May 2019 13:06:55 +0200 Received: from mwinf5c29 ([10.79.5.104]) by opme11ppr07nd1.rouen.francetelecom.fr with LMTP id AF60EM/y21xJDQAA4TOxhQ ; Wed, 15 May 2019 13:06:55 +0200 Received: from campanile-le-havre-centre.fr ([86.229.207.124]) by mwinf5c29 with ME id Cb6u2002c2haSWm01b6uTE; Wed, 15 May 2019 13:06:55 +0200 X-bcc: alain.lubat@orange.fr X-ME-engine: default X-me-spamcause: (0)(0000)gggruggvucftvghtrhhoucdtuddrgeduuddrleekgdefjecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfogfdpggftiffpkfenuceurghilhhouhhtmecugedttdenucenucfjughrpeffhffgvfgtufggsegrkedtredttdejnecuhfhrohhmpehkmhgrrhhtvghlsegtrghmphgrnhhilhgvqdhlvgdqhhgrvhhrvgdqtggvnhhtrhgvrdhfrhenucfkphepkeeirddvvdelrddvtdejrdduvdegnecurfgrrhgrmhephhgvlhhopegtrghmphgrnhhilhgvqdhlvgdqhhgrvhhrvgdqtggvnhhtrhgvrdhfrhdpihhnvghtpeekiedrvddvledrvddtjedruddvgedpmhgrihhlfhhrohhmpehkmhgrrhhtvghlsegtrghmphgrnhhilhgvqdhlvgdqhhgrvhhrvgdqtggvnhhtrhgvrdhfrhdprhgtphhtthhopegrlhgrihhnrdhluhgsrghtsehorhgrnhhgvgdrfhhrnecuvehluhhsthgvrhfuihiivgeptd X-me-spamlevel: not-spam Message-ID: <76a0ebdaef157a20655a6f7948b27990@mwinf5c29.me-wanadoo.net> Date: Wed, 15 May 2019 11:06:54 +0000 X-GIRAUD: 5e142c1b-b0e4-43a1-9dbe-553bd0ef4297 From: kmartel@campanile-le-havre-centre.fr X-SCHMITT: 267935 X-Antivirus-Status: Clean Content-Transfer-Encoding: 8bit X-GUICHARD: 8W0UizEG X-Antivirus: Avast (VPS 131447-4, 15/05/2019), Outbound message To: =?utf-8?Q?alai?= <alain.lubat@orange.fr> Content-Type: multipart/alternative; boundary="------NextPart-e4hhjxio4uhxhe9xwvcubmdsrwz67snt" Subject: =?utf-8?B?UmVjb3V2cmVtZW50?= MIME-Version: 1.0 Envelope-To: <alain@almail.net> X-Spam-Flag: NO X-UI-Filterresults: notjunk:1;V03:K0:u+/PBG4Ihkk=:TQiE2ArcjSlSKk73WtI4jhkp0O 537DKsfLYqBOHKaTAiwxggE+IZGRoWbDeVOpr+r35UswpTLQ/TZnRgZABaXd8aEeW4+6b3dBo VudNC3rATno0TfRwONWX24xT7R0HTtLuvTjt0P12oZofqOz8GWscM1dKawRjZX/DSyGy52F8J 3oynrHAbdEP2hIF2KwCS3K9Qw1rUV5CZy9JXDbKaW4TR0vLarYJxxzHCktQPn/WF10ekMJ6M/ IqjrsmRXJXJsa2auGnDJodzjZz62CTiVGZ7OrRwZ8zjcZWSFtenm7pPoYYitpUsVk77RnAtLL QpsQvhL+x8vIMKoIMAD8Fn+JJZtHjXmfvarRwhQulIWRorV6mMu0ol57DgKh9luXJEHDFmxeR VhrCNiOcZhDc6dumrhL4jhaqFEpfypXmky9QzhGpxmboMWeHjEAC9EGn9Ox8Fayl94XCu7bgJ cHWFLqBeq9KeJvWOrPTlWC/uU/mS9Qj9Q1Sx32CEHI9lVOmAc22NbuvupeoFTsj2bHB1SdU2h a8IEj6XJHSQxCS3gIWK8iFtjYOzDxj94rr7TNYixAVqKR5sMmzT5O56mgXD9fxJboAK/RPXsS ZuHd2nO+i9lAHlk84CNdUqeLLVu7hj7AWDGsutYh9XTI+3FvzE3zbMfJ8KVGnaga9tACOK68k 1roaq2EemK32aZCwm6NLD2UMDiLq9zjcIQNZkF+1uBxzvU9ePtCEjUMi3YNkwhAL/xXnk4/wF aPynWIIFcqMweXN1jYRtaiNnwCcZi5SSmu1HzmEDAxYKBV4N0UVCbntmIuf80RR8d1G1SpisG d2g65H7ZUyVHqX6VvmqO9wyN4xBBO36UUxxTGpzyaE/QCpS+u9UhMOV/Ny4ySVzmSA2tYRb7P sBkcWQP2kG1gUT10MLu8r1q14GHP6/sADKp2m5sWS7bCw4LUPyQqUYwFEeYO0J+LvzGR9v1nq i9/Tr9sqPnL9v+G9s2IOuwCPXaTIwsdlZG0QKWmUwAETsXA7N+c/sFdvH4TI3PIV3mpntca0T yZsJ2CnhVNSYBAjGY1AF28L3Q0a2h0lZ5YETQM5u9dpxLzZ1RaNIafiTBTHvze/ycBxSchm57 CR9G1vqDMLP0bxgspvsW4q0g8KmUAgG1LXiz9Y+NijQEMyl8TfV+9vwI6QTVCeTnE+7vtYIO0 Ut/9CcG81DExm9sRO2a8Za9GOFvhlOqKdS2+cDfjaOo8Ho0KxcVYU1wM/EAHpTGs+oOHWJpGD Ccw4LUUBqWcYUNPosVBmH8JV3/CCdZid4Kxnq/L3eHN5W9E2h78Mb+ySTmBPp1xVSBGL/tjdU UWLh7q3jJPbsX8rS2UEuFvPkV7VrWBN0IdQzF2QnFZgNuHVVz4cRLh27kNKpqJXMPuKx+b6U7 76agSZCN2pXyBhl0JATmKk7Ftu3hMpHO+ibvGD8MxfldJfmhS++jLe1uNL7pIf3sA9nktbt83 XyVswn4iucOvth88H3NGVGbwKEevBzfTWv1MOBTlsrg2N22OS+qoAMneqZQVWdAh3T4WT8WLz dN5HI7b5W0A5t64H9Lkg= --------NextPart-e4hhjxio4uhxhe9xwvcubmdsrwz67snt Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: 8bit Madame, Monsieur, Nous sommes mandatés pour recouvrer le solde débiteur de votre compte, pour un montant de 812,4�¬ (non-paiement de votre crédit à la consommation). Le détail des sommes dues est disponible dans votre ordonnance d'injonction de payer. Nous vous mettons en demeure de régler la somme de 812,4�¬ avant le 16 mai 2019. En vertu du mandat qui nous a été confié dans le cadre d'un recouvrement amiable nous agissons conformément à la loi du 09/07/1991 (art. 32*). Aucuns frais ne vous est réclamé à ce stade de la procédure. Nature de la créance : Non-paiement de votre crédit à la consommation MONTANT TTC : 812,4�¬ Date de limite de paiement : Le 19 mai 2019 Vous pouvez régulariser votre situation avec votre identifiant personnel : 741975 et votre code confidentiel : 662399 par CARTE BANCAIRE soit : * auprès de votre créancier * au numéro indiqué dans l'en-tête de votre ordonnance. En cas de difficultés, vous pouvez contacter un gestionnaire de notre service recouvrement du lundi au vendredi, de 08h00 à 19h00 sans interruption. Sans règlement ou contact de votre part dans le délai imparti, vous vous exposez à la résiliation contentieuse de votre contrat conformément aux conditions générales de ventes et nous serons contraints de transmettre votre dossier à notre service juridique chargé d'engager une procédure contentieuse à votre encontre et qui pourra éventuellement saisir le tribunal afin d'obtenir un titre exécutoire, ce qui ajouterait au principal de la créance les dommages et intérêts légaux, ainsi que ceux demandés au titre de l'Article 700 du Nouveau Code de Procédure Civile. Veuillez agréer, Madame, Monsieur, nos salutations distinguées. Mr KLEIN MARTELService Recouvrement Amiable France-Créances Nota : il est impossible de répondre à ce message électronique pour raison de sécurité et de confidentialité des informations vous concernant. --------NextPart-e4hhjxio4uhxhe9xwvcubmdsrwz67snt Content-Type: text/html; charset=utf-8 Content-Transfer-Encoding: 8bit Madame, Monsieur,<br> <br> Nous sommes mandatés pour recouvrer le solde débiteur de votre compte, pour un montant de 812,4�¬ (non-paiement de votre crédit à la consommation).<br> <br> Le détail des sommes dues est disponible dans votre <b><a style="color: blue;" href="//frama.link/LkFVpJga?13764">ordonnance d'injonction de payer</a></b>.<br> <br> Nous vous mettons en demeure de régler la somme de 812,4�¬ avant le 16 mai 2019.<br> <br> En vertu du mandat qui nous a été confié dans le cadre d'un recouvrement amiable nous agissons conformément à la loi du 09/07/1991 (art. 32*). Aucuns frais ne vous est réclamé à ce stade de la procédure.<br> <br> Nature de la créance : Non-paiement de votre crédit à la consommation<br> MONTANT TTC : 812,4�¬<br> Date de limite de paiement : Le 19 mai 2019<br> <br> Vous pouvez régulariser votre situation avec votre identifiant personnel : 741975 et votre code confidentiel : 662399 par CARTE BANCAIRE soit :<br> * auprès de votre créancier<br> * au numéro indiqué dans l'en-tête de <b><a style="color: blue;" href="//frama.link/LkFVpJga?13764">votre ordonnance</a></b>.<br> <br> En cas de difficultés, vous pouvez contacter un gestionnaire de notre service recouvrement du lundi au vendredi, de 08h00 à 19h00 sans interruption.<br> <br> Sans règlement ou contact de votre part dans le délai imparti, vous vous exposez à la résiliation contentieuse de votre contrat conformément aux conditions générales de ventes et nous serons contraints de transmettre votre dossier à notre service juridique chargé d'engager une procédure contentieuse à votre encontre et qui pourra éventuellement saisir le tribunal afin d'obtenir un titre exécutoire, ce qui ajouterait au principal de la créance les dommages et intérêts légaux, ainsi que ceux demandés au titre de l'Article 700 du Nouveau Code de Procédure Civile.<br> <br> Veuillez agréer, Madame, Monsieur, nos salutations distinguées.<br> <br> Mr KLEIN MARTEL<br> Service Recouvrement Amiable<br> France-Créances<br> <br> <br> Nota : il est impossible de répondre à ce message électronique pour raison de sécurité et de confidentialité des informations vous concernant. --------NextPart-e4hhjxio4uhxhe9xwvcubmdsrwz67snt--

Reported on: 15th, May. 2019
K. bryan is reporting 209.86.89.129

Hard to tell where this is coming from: Return-Path: <bounce@amazon.com> Received: from noehlo.host ([209.86.89.135]) by mdl-squeel.atl.sa.earthlink.net (EarthLink SMTP Server) with SMTP id 1Hr2Pc4wW3Nl34P0; Wed, 15 May 2019 18:56:39 -0400 (EDT) Received: from vxe.bestgrejames.org ([3.1.162.231]) by ibscan-wasp.atl.sa.earthlink.net (EarthLink SMTP Server) with ESMTP id 1Hr2Pb3ka3PGoUn0 for <kbryan@earthlink.net>; Wed, 15 May 2019 18:56:38 -0400 (EDT) From: "Free Samples_"<from@lolzteam.club> To: kbryan@earthlink.net 0, 0 Subject: Congrats! You've Been Selected for FREE Samples. Content-Transfer-Encoding: 7bit Content-Type: text/html; charset="UTF-8" X-Mailer: Microsoft Avondale Mailer Message-ID: <YP48mWjlRKHdVAy74FwKFpe9FzXO0FU3@partners.extranet.microsoft.com> Date: Wed, 15 May 2019 22:40:08 +0200 X-ELNK-Received-Info: sbv=0; sbrc=.0; sbf=00; sbw=000; X-ELNK-Received-Info: spv=1; X-ELNK-AV: 0 X-ELNK-Info: sbv=1; sbrc=-0; sbf=ee; sbw=000; <img alt='' src='http://lolzteam.club/r.php?t=o&d=24852&l=788&c=145517' width='1px' height='1px' style='visibility:hidden'/>

IP identified as: Spammers IP, Reported on: 15th, May. 2019
noble is reporting 105.49.44.31

I want to know the location

IP identified as: Mobile device IP, Reported on: 16th, May. 2019
Maldi is reporting 66.249.88.11

Que es esto?

IP identified as: N / A, Reported on: 21st, May. 2019
Michelle is reporting 10.54.127.200

shows up in web history

Reported on: 21st, May. 2019
greg s is reporting 185.244.143.167

bitcoin extortion email

IP identified as: Hackers IP, Reported on: 21st, May. 2019
syaefudin is reporting 185.244.143.167

Akun saya di baned pihak voinexcange

IP identified as: Mobile device IP, Reported on: 26th, May. 2019
Joe Jackson is reporting 110.235.248.94

Sents a lot of spam..

IP identified as: Spammers IP, Reported on: 28th, May. 2019
Alfred de Jager is reporting 167.179.117.36

167.179.117.36 is a address that is spamming our websites. Please take it down. We can attempts to send comments in a commenting corner of our website edo.jrc.ec.europa.eu from this account. Event started on 20 May, last event was on 27 May 2019.

IP identified as: Hackers IP, Reported on: 30th, May. 2019
123 is reporting 185.129.237.190

222....................................................................

Reported on: 31st, May. 2019
Harriet Reeves is reporting 228.251.147.194

This Mac and ip are using my account. Mac address 01:00:5E:7B:93:C2 wireless 228.251.147.194

IP identified as: Hackers IP, Reported on: 31st, May. 2019
Marge is reporting 103.109.36.77

phishing scam

Reported on: 1st, Jun. 2019
Ryne is reporting 96.239.61.100

They tried to log into my Facebook. Now I'm getting attempts on other accounts including Instagram and Lyft.

Reported on: 1st, Jun. 2019
Sh is reporting 5.208.44.10

Who is up

IP identified as: Mobile device IP, Reported on: 2nd, Jun. 2019
sheel chand jain is reporting 223.184.217.187

IMEI number 866778047921154,mbile is lost,14/02/2019

IP identified as: Mobile device IP, Reported on: 2nd, Jun. 2019
MIHOE MAETA is reporting 125.204.2.210

Hollo Thank you for your help 2.4/12 0.149BTC 3.NANJ COIN Thanking you in advance

IP identified as: 該当なし, Reported on: 3rd, Jun. 2019
MIHOE MAETA is reporting 125.204.2.210

Hollo Thank you for your help 2.4/12 0.149BTC 3.NANJ COIN Thanking you in advance

Reported on: 3rd, Jun. 2019
abd3 is reporting 143.107.200.195

just try to something new

IP identified as: Hackers IP, Reported on: 3rd, Jun. 2019
Roxanne Howlett is reporting 99.22.143.62

Apple Mac ransomware 2019 genetic changes to Roxanne Howlett, Alicia Howlett, Christina Silva by Genetic match Don Wells, Elizabeth Casto. Reanna Donnelly and 1174 genetic match to crime organization attempts to Obtain rights to intellectual, patents, prototypes, tech based intellectual property. Call 909-552-9539 for legal documents request

IP identified as: Residentail IP, Reported on: 4th, Jun. 2019
Lorrr is reporting 112.206.45.189

Spammers

IP identified as: Spammers IP, Reported on: 4th, Jun. 2019
Antonio is reporting 66.168.80.118

This IP tried to access my Facebook.. 66.168.80.118

IP identified as: Hackers IP, Reported on: 6th, Jun. 2019
D is reporting 42.189.241.229

he wanted to login on my steam account with my real password, good i had steamguard enabled

IP identified as: Spammers IP, Reported on: 7th, Jun. 2019
help is reporting 81.82.119.227

Hello my ip is been hijacked pls i need help

IP identified as: This is my IP, Reported on: 7th, Jun. 2019
MJ OConnor is reporting 223.187.149.232

This ip address (223.187.149.232) was used on a Samsung Galaxy J7 NXT, using the Facebook Lite app to try and log in to MY Facebook account and most likely several of my other accounts including PlayStation Network and some other gaming accounts.

IP identified as: Hackers IP, Reported on: 8th, Jun. 2019
stella is reporting 134.3.213.222

46.53.242.207

IP identified as: Hackers IP, Reported on: 10th, Jun. 2019
Previous  25 26 27 28 29 30 31 32 33 34 35 Next 
List of Class A IP ranges (click to view)
* 1.0.0.0 - 1.255.255.255 (1.0.0.0/8)
* 2.0.0.0 - 2.255.255.255 (2.0.0.0/8)
* 3.0.0.0 - 3.255.255.255 (3.0.0.0/8)
* 4.0.0.0 - 4.255.255.255 (4.0.0.0/8)
* 5.0.0.0 - 5.255.255.255 (5.0.0.0/8)
* 6.0.0.0 - 6.255.255.255 (6.0.0.0/8)
* 7.0.0.0 - 7.255.255.255 (7.0.0.0/8)
* 8.0.0.0 - 8.255.255.255 (8.0.0.0/8)
* 9.0.0.0 - 9.255.255.255 (9.0.0.0/8)
* 10.0.0.0 - 10.255.255.255 (10.0.0.0/8)
* 11.0.0.0 - 11.255.255.255 (11.0.0.0/8)
* 12.0.0.0 - 12.255.255.255 (12.0.0.0/8)
* 13.0.0.0 - 13.255.255.255 (13.0.0.0/8)
* 14.0.0.0 - 14.255.255.255 (14.0.0.0/8)
* 15.0.0.0 - 15.255.255.255 (15.0.0.0/8)
* 16.0.0.0 - 16.255.255.255 (16.0.0.0/8)
* 17.0.0.0 - 17.255.255.255 (17.0.0.0/8)
* 18.0.0.0 - 18.255.255.255 (18.0.0.0/8)
* 19.0.0.0 - 19.255.255.255 (19.0.0.0/8)
* 20.0.0.0 - 20.255.255.255 (20.0.0.0/8)
* 21.0.0.0 - 21.255.255.255 (21.0.0.0/8)
* 22.0.0.0 - 22.255.255.255 (22.0.0.0/8)
* 23.0.0.0 - 23.255.255.255 (23.0.0.0/8)
* 24.0.0.0 - 24.255.255.255 (24.0.0.0/8)
* 25.0.0.0 - 25.255.255.255 (25.0.0.0/8)
* 26.0.0.0 - 26.255.255.255 (26.0.0.0/8)
* 27.0.0.0 - 27.255.255.255 (27.0.0.0/8)
* 28.0.0.0 - 28.255.255.255 (28.0.0.0/8)
* 29.0.0.0 - 29.255.255.255 (29.0.0.0/8)
* 30.0.0.0 - 30.255.255.255 (30.0.0.0/8)
* 31.0.0.0 - 31.255.255.255 (31.0.0.0/8)
* 32.0.0.0 - 32.255.255.255 (32.0.0.0/8)
* 33.0.0.0 - 33.255.255.255 (33.0.0.0/8)
* 34.0.0.0 - 34.255.255.255 (34.0.0.0/8)
* 35.0.0.0 - 35.255.255.255 (35.0.0.0/8)
* 36.0.0.0 - 36.255.255.255 (36.0.0.0/8)
* 37.0.0.0 - 37.255.255.255 (37.0.0.0/8)
* 38.0.0.0 - 38.255.255.255 (38.0.0.0/8)
* 39.0.0.0 - 39.255.255.255 (39.0.0.0/8)
* 40.0.0.0 - 40.255.255.255 (40.0.0.0/8)
* 41.0.0.0 - 41.255.255.255 (41.0.0.0/8)
* 42.0.0.0 - 42.255.255.255 (42.0.0.0/8)
* 43.0.0.0 - 43.255.255.255 (43.0.0.0/8)
* 44.0.0.0 - 44.255.255.255 (44.0.0.0/8)
* 45.0.0.0 - 45.255.255.255 (45.0.0.0/8)
* 46.0.0.0 - 46.255.255.255 (46.0.0.0/8)
* 47.0.0.0 - 47.255.255.255 (47.0.0.0/8)
* 48.0.0.0 - 48.255.255.255 (48.0.0.0/8)
* 49.0.0.0 - 49.255.255.255 (49.0.0.0/8)
* 50.0.0.0 - 50.255.255.255 (50.0.0.0/8)
* 51.0.0.0 - 51.255.255.255 (51.0.0.0/8)
* 52.0.0.0 - 52.255.255.255 (52.0.0.0/8)
* 53.0.0.0 - 53.255.255.255 (53.0.0.0/8)
* 54.0.0.0 - 54.255.255.255 (54.0.0.0/8)
* 55.0.0.0 - 55.255.255.255 (55.0.0.0/8)
* 56.0.0.0 - 56.255.255.255 (56.0.0.0/8)
* 57.0.0.0 - 57.255.255.255 (57.0.0.0/8)
* 58.0.0.0 - 58.255.255.255 (58.0.0.0/8)
* 59.0.0.0 - 59.255.255.255 (59.0.0.0/8)
* 60.0.0.0 - 60.255.255.255 (60.0.0.0/8)
* 61.0.0.0 - 61.255.255.255 (61.0.0.0/8)
* 62.0.0.0 - 62.255.255.255 (62.0.0.0/8)
* 63.0.0.0 - 63.255.255.255 (63.0.0.0/8)
* 64.0.0.0 - 64.255.255.255 (64.0.0.0/8)
* 65.0.0.0 - 65.255.255.255 (65.0.0.0/8)
* 66.0.0.0 - 66.255.255.255 (66.0.0.0/8)
* 67.0.0.0 - 67.255.255.255 (67.0.0.0/8)
* 68.0.0.0 - 68.255.255.255 (68.0.0.0/8)
* 69.0.0.0 - 69.255.255.255 (69.0.0.0/8)
* 70.0.0.0 - 70.255.255.255 (70.0.0.0/8)
* 71.0.0.0 - 71.255.255.255 (71.0.0.0/8)
* 72.0.0.0 - 72.255.255.255 (72.0.0.0/8)
* 73.0.0.0 - 73.255.255.255 (73.0.0.0/8)
* 74.0.0.0 - 74.255.255.255 (74.0.0.0/8)
* 75.0.0.0 - 75.255.255.255 (75.0.0.0/8)
* 76.0.0.0 - 76.255.255.255 (76.0.0.0/8)
* 77.0.0.0 - 77.255.255.255 (77.0.0.0/8)
* 78.0.0.0 - 78.255.255.255 (78.0.0.0/8)
* 79.0.0.0 - 79.255.255.255 (79.0.0.0/8)
* 80.0.0.0 - 80.255.255.255 (80.0.0.0/8)
* 81.0.0.0 - 81.255.255.255 (81.0.0.0/8)
* 82.0.0.0 - 82.255.255.255 (82.0.0.0/8)
* 83.0.0.0 - 83.255.255.255 (83.0.0.0/8)
* 84.0.0.0 - 84.255.255.255 (84.0.0.0/8)
* 85.0.0.0 - 85.255.255.255 (85.0.0.0/8)
* 86.0.0.0 - 86.255.255.255 (86.0.0.0/8)
* 87.0.0.0 - 87.255.255.255 (87.0.0.0/8)
* 88.0.0.0 - 88.255.255.255 (88.0.0.0/8)
* 89.0.0.0 - 89.255.255.255 (89.0.0.0/8)
* 90.0.0.0 - 90.255.255.255 (90.0.0.0/8)
* 91.0.0.0 - 91.255.255.255 (91.0.0.0/8)
* 92.0.0.0 - 92.255.255.255 (92.0.0.0/8)
* 93.0.0.0 - 93.255.255.255 (93.0.0.0/8)
* 94.0.0.0 - 94.255.255.255 (94.0.0.0/8)
* 95.0.0.0 - 95.255.255.255 (95.0.0.0/8)
* 96.0.0.0 - 96.255.255.255 (96.0.0.0/8)
* 97.0.0.0 - 97.255.255.255 (97.0.0.0/8)
* 98.0.0.0 - 98.255.255.255 (98.0.0.0/8)
* 99.0.0.0 - 99.255.255.255 (99.0.0.0/8)
* 100.0.0.0 - 100.255.255.255 (100.0.0.0/8)
* 101.0.0.0 - 101.255.255.255 (101.0.0.0/8)
* 102.0.0.0 - 102.255.255.255 (102.0.0.0/8)
* 103.0.0.0 - 103.255.255.255 (103.0.0.0/8)
* 104.0.0.0 - 104.255.255.255 (104.0.0.0/8)
* 105.0.0.0 - 105.255.255.255 (105.0.0.0/8)
* 106.0.0.0 - 106.255.255.255 (106.0.0.0/8)
* 107.0.0.0 - 107.255.255.255 (107.0.0.0/8)
* 108.0.0.0 - 108.255.255.255 (108.0.0.0/8)
* 109.0.0.0 - 109.255.255.255 (109.0.0.0/8)
* 110.0.0.0 - 110.255.255.255 (110.0.0.0/8)
* 111.0.0.0 - 111.255.255.255 (111.0.0.0/8)
* 112.0.0.0 - 112.255.255.255 (112.0.0.0/8)
* 113.0.0.0 - 113.255.255.255 (113.0.0.0/8)
* 114.0.0.0 - 114.255.255.255 (114.0.0.0/8)
* 115.0.0.0 - 115.255.255.255 (115.0.0.0/8)
* 116.0.0.0 - 116.255.255.255 (116.0.0.0/8)
* 117.0.0.0 - 117.255.255.255 (117.0.0.0/8)
* 118.0.0.0 - 118.255.255.255 (118.0.0.0/8)
* 119.0.0.0 - 119.255.255.255 (119.0.0.0/8)
* 120.0.0.0 - 120.255.255.255 (120.0.0.0/8)
* 121.0.0.0 - 121.255.255.255 (121.0.0.0/8)
* 122.0.0.0 - 122.255.255.255 (122.0.0.0/8)
* 123.0.0.0 - 123.255.255.255 (123.0.0.0/8)
* 124.0.0.0 - 124.255.255.255 (124.0.0.0/8)
* 125.0.0.0 - 125.255.255.255 (125.0.0.0/8)
* 126.0.0.0 - 126.255.255.255 (126.0.0.0/8)
* 127.0.0.0 - 127.255.255.255 (127.0.0.0/8)
* 128.0.0.0 - 128.255.255.255 (128.0.0.0/8)
* 129.0.0.0 - 129.255.255.255 (129.0.0.0/8)
* 130.0.0.0 - 130.255.255.255 (130.0.0.0/8)
* 131.0.0.0 - 131.255.255.255 (131.0.0.0/8)
* 132.0.0.0 - 132.255.255.255 (132.0.0.0/8)
* 133.0.0.0 - 133.255.255.255 (133.0.0.0/8)
* 134.0.0.0 - 134.255.255.255 (134.0.0.0/8)
* 135.0.0.0 - 135.255.255.255 (135.0.0.0/8)
* 136.0.0.0 - 136.255.255.255 (136.0.0.0/8)
* 137.0.0.0 - 137.255.255.255 (137.0.0.0/8)
* 138.0.0.0 - 138.255.255.255 (138.0.0.0/8)
* 139.0.0.0 - 139.255.255.255 (139.0.0.0/8)
* 140.0.0.0 - 140.255.255.255 (140.0.0.0/8)
* 141.0.0.0 - 141.255.255.255 (141.0.0.0/8)
* 142.0.0.0 - 142.255.255.255 (142.0.0.0/8)
* 143.0.0.0 - 143.255.255.255 (143.0.0.0/8)
* 144.0.0.0 - 144.255.255.255 (144.0.0.0/8)
* 145.0.0.0 - 145.255.255.255 (145.0.0.0/8)
* 146.0.0.0 - 146.255.255.255 (146.0.0.0/8)
* 147.0.0.0 - 147.255.255.255 (147.0.0.0/8)
* 148.0.0.0 - 148.255.255.255 (148.0.0.0/8)
* 149.0.0.0 - 149.255.255.255 (149.0.0.0/8)
* 150.0.0.0 - 150.255.255.255 (150.0.0.0/8)
* 151.0.0.0 - 151.255.255.255 (151.0.0.0/8)
* 152.0.0.0 - 152.255.255.255 (152.0.0.0/8)
* 153.0.0.0 - 153.255.255.255 (153.0.0.0/8)
* 154.0.0.0 - 154.255.255.255 (154.0.0.0/8)
* 155.0.0.0 - 155.255.255.255 (155.0.0.0/8)
* 156.0.0.0 - 156.255.255.255 (156.0.0.0/8)
* 157.0.0.0 - 157.255.255.255 (157.0.0.0/8)
* 158.0.0.0 - 158.255.255.255 (158.0.0.0/8)
* 159.0.0.0 - 159.255.255.255 (159.0.0.0/8)
* 160.0.0.0 - 160.255.255.255 (160.0.0.0/8)
* 161.0.0.0 - 161.255.255.255 (161.0.0.0/8)
* 162.0.0.0 - 162.255.255.255 (162.0.0.0/8)
* 163.0.0.0 - 163.255.255.255 (163.0.0.0/8)
* 164.0.0.0 - 164.255.255.255 (164.0.0.0/8)
* 165.0.0.0 - 165.255.255.255 (165.0.0.0/8)
* 166.0.0.0 - 166.255.255.255 (166.0.0.0/8)
* 167.0.0.0 - 167.255.255.255 (167.0.0.0/8)
* 168.0.0.0 - 168.255.255.255 (168.0.0.0/8)
* 169.0.0.0 - 169.255.255.255 (169.0.0.0/8)
* 170.0.0.0 - 170.255.255.255 (170.0.0.0/8)
* 171.0.0.0 - 171.255.255.255 (171.0.0.0/8)
* 172.0.0.0 - 172.255.255.255 (172.0.0.0/8)
* 173.0.0.0 - 173.255.255.255 (173.0.0.0/8)
* 174.0.0.0 - 174.255.255.255 (174.0.0.0/8)
* 175.0.0.0 - 175.255.255.255 (175.0.0.0/8)
* 176.0.0.0 - 176.255.255.255 (176.0.0.0/8)
* 177.0.0.0 - 177.255.255.255 (177.0.0.0/8)
* 178.0.0.0 - 178.255.255.255 (178.0.0.0/8)
* 179.0.0.0 - 179.255.255.255 (179.0.0.0/8)
* 180.0.0.0 - 180.255.255.255 (180.0.0.0/8)
* 181.0.0.0 - 181.255.255.255 (181.0.0.0/8)
* 182.0.0.0 - 182.255.255.255 (182.0.0.0/8)
* 183.0.0.0 - 183.255.255.255 (183.0.0.0/8)
* 184.0.0.0 - 184.255.255.255 (184.0.0.0/8)
* 185.0.0.0 - 185.255.255.255 (185.0.0.0/8)
* 186.0.0.0 - 186.255.255.255 (186.0.0.0/8)
* 187.0.0.0 - 187.255.255.255 (187.0.0.0/8)
* 188.0.0.0 - 188.255.255.255 (188.0.0.0/8)
* 189.0.0.0 - 189.255.255.255 (189.0.0.0/8)
* 190.0.0.0 - 190.255.255.255 (190.0.0.0/8)
* 191.0.0.0 - 191.255.255.255 (191.0.0.0/8)
* 192.0.0.0 - 192.255.255.255 (192.0.0.0/8)
* 193.0.0.0 - 193.255.255.255 (193.0.0.0/8)
* 194.0.0.0 - 194.255.255.255 (194.0.0.0/8)
* 195.0.0.0 - 195.255.255.255 (195.0.0.0/8)
* 196.0.0.0 - 196.255.255.255 (196.0.0.0/8)
* 197.0.0.0 - 197.255.255.255 (197.0.0.0/8)
* 198.0.0.0 - 198.255.255.255 (198.0.0.0/8)
* 199.0.0.0 - 199.255.255.255 (199.0.0.0/8)
* 200.0.0.0 - 200.255.255.255 (200.0.0.0/8)
* 201.0.0.0 - 201.255.255.255 (201.0.0.0/8)
* 202.0.0.0 - 202.255.255.255 (202.0.0.0/8)
* 203.0.0.0 - 203.255.255.255 (203.0.0.0/8)
* 204.0.0.0 - 204.255.255.255 (204.0.0.0/8)
* 205.0.0.0 - 205.255.255.255 (205.0.0.0/8)
* 206.0.0.0 - 206.255.255.255 (206.0.0.0/8)
* 207.0.0.0 - 207.255.255.255 (207.0.0.0/8)
* 208.0.0.0 - 208.255.255.255 (208.0.0.0/8)
* 209.0.0.0 - 209.255.255.255 (209.0.0.0/8)
* 210.0.0.0 - 210.255.255.255 (210.0.0.0/8)
* 211.0.0.0 - 211.255.255.255 (211.0.0.0/8)
* 212.0.0.0 - 212.255.255.255 (212.0.0.0/8)
* 213.0.0.0 - 213.255.255.255 (213.0.0.0/8)
* 214.0.0.0 - 214.255.255.255 (214.0.0.0/8)
* 215.0.0.0 - 215.255.255.255 (215.0.0.0/8)
* 216.0.0.0 - 216.255.255.255 (216.0.0.0/8)
* 217.0.0.0 - 217.255.255.255 (217.0.0.0/8)
* 218.0.0.0 - 218.255.255.255 (218.0.0.0/8)
* 219.0.0.0 - 219.255.255.255 (219.0.0.0/8)
* 220.0.0.0 - 220.255.255.255 (220.0.0.0/8)
* 221.0.0.0 - 221.255.255.255 (221.0.0.0/8)
* 222.0.0.0 - 222.255.255.255 (222.0.0.0/8)
* 223.0.0.0 - 223.255.255.255 (223.0.0.0/8)
* 224.0.0.0 - 224.255.255.255 (224.0.0.0/8)
* 225.0.0.0 - 225.255.255.255 (225.0.0.0/8)
* 226.0.0.0 - 226.255.255.255 (226.0.0.0/8)
* 227.0.0.0 - 227.255.255.255 (227.0.0.0/8)
* 228.0.0.0 - 228.255.255.255 (228.0.0.0/8)
* 229.0.0.0 - 229.255.255.255 (229.0.0.0/8)
* 230.0.0.0 - 230.255.255.255 (230.0.0.0/8)
* 231.0.0.0 - 231.255.255.255 (231.0.0.0/8)
* 232.0.0.0 - 232.255.255.255 (232.0.0.0/8)
* 233.0.0.0 - 233.255.255.255 (233.0.0.0/8)
* 234.0.0.0 - 234.255.255.255 (234.0.0.0/8)
* 235.0.0.0 - 235.255.255.255 (235.0.0.0/8)
* 236.0.0.0 - 236.255.255.255 (236.0.0.0/8)
* 237.0.0.0 - 237.255.255.255 (237.0.0.0/8)
* 238.0.0.0 - 238.255.255.255 (238.0.0.0/8)
* 239.0.0.0 - 239.255.255.255 (239.0.0.0/8)
* 240.0.0.0 - 240.255.255.255 (240.0.0.0/8)
* 241.0.0.0 - 241.255.255.255 (241.0.0.0/8)
* 242.0.0.0 - 242.255.255.255 (242.0.0.0/8)
* 243.0.0.0 - 243.255.255.255 (243.0.0.0/8)
* 244.0.0.0 - 244.255.255.255 (244.0.0.0/8)
* 245.0.0.0 - 245.255.255.255 (245.0.0.0/8)
* 246.0.0.0 - 246.255.255.255 (246.0.0.0/8)
* 247.0.0.0 - 247.255.255.255 (247.0.0.0/8)
* 248.0.0.0 - 248.255.255.255 (248.0.0.0/8)
* 249.0.0.0 - 249.255.255.255 (249.0.0.0/8)
* 250.0.0.0 - 250.255.255.255 (250.0.0.0/8)
* 251.0.0.0 - 251.255.255.255 (251.0.0.0/8)
* 252.0.0.0 - 252.255.255.255 (252.0.0.0/8)
* 253.0.0.0 - 253.255.255.255 (253.0.0.0/8)
* 254.0.0.0 - 254.255.255.255 (254.0.0.0/8)
* 255.0.0.0 - 255.255.255.255 (255.0.0.0/8)