
IP Lookup Details:
IP Information - 51.210.90.250
Host name: ip250.ip-51-210-90.eu
Country: France
Country Code: FR
Region:
City:
Latitude: 48.8582
Longitude: 2.3387

CIDR: 51.0.0.0/8
NetName: RIPE-ERX-51
NetHandle: NET-51-0-0-0-1
Parent: ()
NetType: Early Registrations, Maintained by RIPE NCC
OriginAS:
Organization: RIPE Network Coordination Centre (RIPE)
RegDate: 1991-09-16
Updated: 2025-02-10
Comment: These addresses have been further assigned to users in the RIPE NCC region. Please note that the organization and point of contact details listed below are those of the RIPE NCC not the current address holder. ** You can find user contact information for the current address holder in the RIPE database at http://www.ripe.net/whois.
Ref: https://rdap.arin.net/registry/ip/51.0.0.0
ResourceLink: https://apps.db.ripe.net/db-web-ui/query
ResourceLink: whois.ripe.net
OrgName: RIPE Network Coordination Centre
OrgId: RIPE
Address: P.O. Box 10096
City: Amsterdam
StateProv:
PostalCode: 1001EB
Country: NL
RegDate:
Updated: 2013-07-29
Ref: https://rdap.arin.net/registry/entity/RIPE
ReferralServer: whois.ripe.net
ResourceLink: https://apps.db.ripe.net/db-web-ui/query
OrgTechHandle: RNO29-ARIN
OrgTechName: RIPE NCC Operations
OrgTechPhone: +31 20 535 4444
OrgTechEmail: hostmaster@ripe.net
OrgTechRef: https://rdap.arin.net/registry/entity/RNO29-ARIN
OrgAbuseHandle: ABUSE3850-ARIN
OrgAbuseName: Abuse Contact
OrgAbusePhone: +31205354444
OrgAbuseEmail: abuse@ripe.net
OrgAbuseRef: https://rdap.arin.net/registry/entity/ABUSE3850-ARIN
ENGLISH Version : Hello Webmasters of Society zellaklaimaol.com, and SIGNAL SPAM, LA POSTE, and EUROPOL ( in hidden copies ), Again these same emails of bank Phishing in December 2020, since year 2007 ( all Datafiles with HTML codes storaged ) ! Today Sunday 06 December 2020 after 20h07 PM ( always by nights or early mornings, or week-ends, or before or after opening of Offices and Administrations in FRANCE, I have just receive again this same email of Bank phishing in name of French CPAM ( Ameli.fr ) from email stolen : newsletter@zellaklaimaol.com and ( again ) from IP addresses from the PC or Smartphone of theses crazy hackers : 51.210.90.250 Received : from zellaklaimaol.com (ip250.ip-51-210-90.eu [51.210.90.250]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) using address IP and emails from Society zellaklaimaol.com Herebelow ( after French Version ) this complete email with all references HTML : VERSION FRANÇAISE : RECEPTION nouvel email d’escroquerie usurpant la CPAM, et AMELI.fr en France avec adresse email émettrice bidon : Bonjour Webmasters de SIGNAL SPAM, de AMELI.fr, de la CPAM, et LA POSTE.net, Et ces escroqueries continuent encore en Décembre 2020, et ceci depuis au moins +13 années ( archivés complets avec tous leurs codes HTML depuis 2007 ) ! CE soir Dimanche 06 Décembre 2020 après 20h07 du soir ( souvent soit les nuits, ou tôt les matinées, les week-ends, ou avant ou après les ouvertures ou fermetures des Bureaux et Administrations en France )( méthodes d’escrocs et de faux culs ) j'ai encore reçu sur ma boite email ( ele.lemoine@laposte.net ) ce même email ci-dessous d’escroquerie usurpant la CPAM et venant cette fois-ci de l'adresse email d’escroquerie: newsletter@zellaklaimaol.com L’adresse IP utilisée par le PC ou le smartphone de ces hackers fous est : 51.210.90.250 Received : from zellaklaimaol.com (ip250.ip-51-210-90.eu [51.210.90.250]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) IP Lookup Details: IP Information - 51.210.90.250 Host name: ip250.ip-51-210-90.eu Country: France Country Code: FR Region: City: Latitude: 48.8582 Longitude: 2.3387 utilisant aussi les emails de la Société zellaklaimaol.com C'est clairement une tentative d’escroquerie usurpant la CPAM et AMELI.fr ! Ci-dessous cet email d’escroquerie avec ces en-têtes complets : ************************************************************ CPAMFR : Dossier Réf : AML912-10-035 • Aujourd'hui, à 20:07 (il y a une heure) • • • De : Finalisez votre demande • A : ele.lemoine@laposte.net • Bonjour Malgré plusieurs relances téléphoniques et courriers, nous constatons que vous avez toujours uniremboursementidisponible sur votre espaceipersonnel d'un montant de 495,75 € . Le RIBlenregistré sur votre espaceipersonnel n'a pas pu être créditélpour le motif suivant : 1. Le numéro de téléphone enregistré sur votre espace personnel ne correspond pas à celui associé à votre compteibancaire. Pour accepter leipaiementlrapide en ligne, cliquez sur le lien suivant et sélectionnez une;méthode deiremboursementl. • Modifier vos informations personnelles. • Valider votre demande avec un code de confirmation SMS. Cordialement, Votre correspondant de l'assuranceiMaladie. Adresse : 50 Avenue du Professeur André Lemierre, 75020 Paris ********************** CODE HTML ci-dessous ********************************** Return-Path : <newsletter@zellaklaimaol.com> Received : from mlpnf0114.laposte.net (mlpnf0114.sys.meshcore.net [10.94.128.93]) by mlpnb0108 with LMTPA; Sun, 06 Dec 2020 20:07:48 +0100 X-Cyrus-Session-Id : cyrus-324637-1607281668-2-4448574164045256346 X-Sieve : CMU Sieve 3.0 X-mail-filterd : {"version":"1.2.0","queueID":"4Cpwtr2LcCzjWvp","contextId":"c82ceaa4-bb95-4abd-b93c-b7dfa06930a0"} X-ppbforward : {"queueID":"4Cpwtr2LcCzjWvp","server":"mlpnf0114"} Received : from outgoing-mail.laposte.net (localhost.localdomain [127.0.0.1]) by mlpnf0114.laposte.net (SMTP Server) with ESMTP id 4Cpwtr2LcCzjWvp for <lpn000000000000000018870443@back01-mail02-04.lpn.svc.meshcore.net>; Sun, 6 Dec 2020 20:07:48 +0100 (CET) X-mail-filterd : {"version":"1.2.0","queueID":"4Cpwtr1XkqzjWvw","contextId":"12d51882-292b-4c55-8ff7-486f1f240596"} X-lpn-mailing : LEGIT X-lpn-spamrating : 40 X-lpn-spamlevel : not-spam Authentication-Results : laposte.net; spf=pass smtp.mailfrom=newsletter@zellaklaimaol.com smtp.helo=zellaklaimaol.com; dkim=none; dmarc=pass reason="SPF is aligned, DKIM is not aligned" X-List-Unsubscribe : <https://zellaklaimaol.com?mailpoet_router&endpoint=track&action=click&data=WyI0OTIiLCJqb2JucWJ4a3NqNHNrMGs4c3c4a3drczhvNHcwZzRnYyIsIjciLCJjYzA2NDBkYTFjNzAiLGZhbHNlXQ> X-lpn-spamcause : OK, (0)(0000)gggruggvucftvghtrhhoucdtuddrgedujedrudejvddguddvvdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfntefrqffuvffgpdggtfgfnhhsuhgsshgtrhhisggvnecuuegrihhlohhuthemuceftddtnecunecujfgurhepvffufffhrhfkoffjgggtgfesrgekreerhedtjeenucfhrhhomhephfhinhgrlhhishgviicuvhhothhrvgcuuggvmhgrnhguvgcuoehnvgifshhlvghtthgvrhesiigvlhhlrghklhgrihhmrgholhdrtghomheqnecuggftrfgrthhtvghrnhepvedthefftedugfelkeeggffggfdutdfgteevueelgfegieevuddtteeihfdvgfegnecuffhomhgrihhnpeiivghllhgrkhhlrghimhgrohhlrdgtohhmnecukfhppeehuddrvddutddrledtrddvhedtnecuvehluhhsthgvrhfuihiivgepvdenucfrrghrrghmpehhvghlohepiigvlhhlrghklhgrihhmrgholhdrtghomhdpihhnvghtpeehuddrvddutddrledtrddvhedtpdhmrghilhhfrhhomhepnhgvfihslhgvthhtvghrseiivghllhgrkhhlrghimhgrohhlrdgtohhmpdhrtghpthhtohepvghlvgdrlhgvmhhoihhnvgeslhgrphhoshhtvgdrnhgvth Received : from zellaklaimaol.com (ip250.ip-51-210-90.eu [51.210.90.250]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by mlpnf0114.laposte.net (SMTP Server) with ESMTPS id 4Cpwtr1XkqzjWvw for <ele.lemoine@laposte.net>; Sun, 6 Dec 2020 20:07:48 +0100 (CET) Received : by zellaklaimaol.com (Postfix, from userid 10000) id CBB3098A1514; Sun, 6 Dec 2020 19:07:41 +0000 (UTC) To : ele.lemoine@laposte.net Subject : CPAMFR : Dossier Réf : AML912-10-035 Date : Sun, 6 Dec 2020 19:07:41 +0000 From : Finalisez votre demande <newsletter@zellaklaimaol.com> Reply-To : Finalisez votre demande <sterilisationa@aol.com> Message-ID : <iRBKKcRWRXJe3E2zBNSVCbfae1J28TbAAuFUPiAnYs@zellaklaimaol.com> X-Mailer : PHPMailer 6.1.6 (https://github.com/PHPMailer/PHPMailer) List-Unsubscribe : https://zellaklaimaol.com?mailpoet_router&endpoint=track&action=click&data=WyI0OTIiLCJqb2JucWJ4a3NqNHNrMGs4c3c4a3drczhvNHcwZzRnYyIsIjciLCJjYzA2NDBkYTFjNzAiLGZhbHNlXQ MIME-Version : 1.0 Content-Type : multipart/alternative; boundary="b1_iRBKKcRWRXJe3E2zBNSVCbfae1J28TbAAuFUPiAnYs" Content-Transfer-Encoding : 8bit